KEGG   Staphylococcus epidermidis ATCC 12228: SE_p410Help
Entry
SE_p410           CDS       T00110                                 

Definition
(RefSeq) recombinase
Organism
sep  Staphylococcus epidermidis ATCC 12228
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Resolvase HTH_7 HTH_23 CENP-B_N HTH_29 HTH_28 DUF2802 HTH_38 HTH_40 HTH_22 Sigma70_r4 GerE HTH_Tnp_IS630 HTH_11 TnsD DUF433 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-GeneID: 1463502
NCBI-ProteinID: NP_863235
UniProt: A0A0H2VIS1
Position
pSE-12228-04:complement(9094..9705)
Genome map
AA seq 203 aa AA seqDB search
MIVGYARVSSVDQNLERQLENLKTFGAEKIFTEKQSGQSIENRPVFQEALNFVRMGDRFV
VESIDRLGRNYDEVINTVNYLKEKEVQLMITSLPMMNEVIGNPLLDKFMKDLIIQILAMV
SEQERNESKRRQAQGIQVAKEKGVYKGRPLLYSPNAKDPQKRVIYHRVVEMLEEGKAISK
IAKEVNITRQTVYRIKHDNDDLF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattgtgggctatgcgcgggtatcatcagtagatcaaaatttagaaagacaacttgaa
aatttaaaaacatttggtgctgaaaaaatttttacagaaaaacaatcaggtcaatctata
gaaaacagacccgtctttcaagaagcattgaactttgtgagaatgggagatcgttttgtc
gtggaatcaattgatcgtttaggtcgtaattatgatgaagtcattaataccgttaattat
cttaaagagaaagaagtacaattgatgattaccagtctaccaatgatgaatgaagtcatt
ggtaatccattattagataaatttatgaaagatttaattatacagatattagcaatggtt
tcagaacaagaaagaaatgaaagtaaacgtcgacaagctcaagggattcaagttgcgaaa
gagaaaggcgtatataaaggacgacctttattatattctcccaatgcgaaagatcctcaa
aaacgtgttatctatcatcgtgttgtagaaatgttagaggaaggcaaagcgattagtaaa
attgcgaaagaagtgaatattacaagacaaactgtttatagaattaaacacgataacgat
gatttgttttaa

DBGET integrated database retrieval system