KEGG   Staphylococcus epidermidis ATCC 12228: SE0346Help
Entry
SE0346            CDS       T00110                                 

Definition
(RefSeq) acetyl-CoA c-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00071  Fatty acid degradation
sep00072  Synthesis and degradation of ketone bodies
sep00280  Valine, leucine and isoleucine degradation
sep00310  Lysine degradation
sep00362  Benzoate degradation
sep00380  Tryptophan metabolism
sep00620  Pyruvate metabolism
sep00630  Glyoxylate and dicarboxylate metabolism
sep00640  Propanoate metabolism
sep00650  Butanoate metabolism
sep00900  Terpenoid backbone biosynthesis
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
sep01212  Fatty acid metabolism
sep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE0346
   00630 Glyoxylate and dicarboxylate metabolism
    SE0346
   00640 Propanoate metabolism
    SE0346
   00650 Butanoate metabolism
    SE0346
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SE0346
   00072 Synthesis and degradation of ketone bodies
    SE0346
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE0346
   00310 Lysine degradation
    SE0346
   00380 Tryptophan metabolism
    SE0346
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SE0346
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SE0346
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SE0346
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sep04147]
    SE0346
Enzymes [BR:sep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SE0346
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SE0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 1056791
NCBI-ProteinID: NP_763901
UniProt: Q8CTR0
Position
345378..346526
Genome map
AA seq 382 aa AA seqDB search
MKQPVIIAAKRIAFGKYGGRLRHLEPESLLEPLFNHFTDQYPKVMSLLDDVILGNTVGNG
GNLARKSLLEAGLDFKIPGITIDRQCGSGLEAVIQACRMVQSGAGTIYIAGGVESTSRAP
WKIKRPQSVYESEFPQFFERAPFAREGEDPSMIEAAENVAKKYHISRNEQDDFAYRSHQL
ASKNMNNGNISQEILPFKVKGEYFNQDESIKPQLTLRTLGRLKPLLNEGTVTVGNSCKKN
DGAVLLIVMEENRARQLGFTEGIKFVNSATVGVQPQYLGVGPVPAVNQLLAQERLTINDI
NAVELNEAFSSQVIASQQQLNIPLNKLNCWGGAIATGHPYGASGAALVTRLFYMKHQFRT
IATMGIGGGIGNAALFERWYGN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgttattattgcagcaaaacgtatagctttcggtaagtatggtggccga
ttgaggcatttagaacctgaatcattactagaacctttatttaatcattttacagatcag
tatccaaaagtaatgtctcttttggatgacgtcattttaggtaatacggtaggtaatggg
gggaatttagctagaaaatcattacttgaagcgggattagattttaaaatacctggtata
acaattgatcgtcaatgtggctcaggtcttgaagccgttatacaagcctgtaggatggta
caaagtggtgctggaacaatatatattgcaggtggtgttgagagtaccagtagagcacct
tggaaaatcaaacgtccgcagtcagtttatgaatctgagtttccacaattttttgaacgg
gcgccttttgcaagagaaggagaagacccttcaatgattgaagcagccgaaaatgtagcg
aagaaatatcatatcagtagaaatgaacaagatgactttgcgtatcgcagtcatcagttg
gcatcaaaaaatatgaataacggtaatatttcccaagaaattttaccgttcaaagtgaaa
ggtgaatattttaatcaagatgaaagtattaaacctcaacttactctcagaacacttggc
agacttaaaccacttttaaatgaaggaacagtcacagtaggaaatagttgtaagaaaaat
gatggtgcagtattactgattgttatggaagaaaatcgggcacgtcaattaggattcaca
gaagggattaagtttgtgaatagtgcaactgtaggtgttcaaccacagtatttaggagta
ggtccagtgccagcagtaaatcaattattagctcaagaacgattaactataaatgatata
aatgcagtagaattaaatgaagcatttagctctcaagttattgcgagccaacaacagctt
aacattcctttgaataagttgaattgttggggaggagcaattgctacagggcatccatat
ggtgcaagtggagcagcgttagtcacacgtttattttatatgaaacatcaatttagaact
atagcaactatgggaataggtggagggataggaaatgcagctttatttgaaagatggtat
ggaaattag

DBGET integrated database retrieval system