KEGG   Staphylococcus epidermidis ATCC 12228: SE0375Help
Entry
SE0375            CDS       T00110                                 

Gene name
adhA, adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00071  Fatty acid degradation
sep00350  Tyrosine metabolism
sep00625  Chloroalkane and chloroalkene degradation
sep00626  Naphthalene degradation
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0375 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SE0375 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    SE0375 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SE0375 (adhA)
   00626 Naphthalene degradation
    SE0375 (adhA)
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SE0375 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C 2-Hacid_dh_C ADH_N_2 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 1056765
NCBI-ProteinID: NP_763930
UniProt: Q8CQ56
Position
373594..374616
Genome map
AA seq 340 aa AA seqDB search
MKAAVVTKDHRVSIEEKRLRELRPGEALVKTEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGRVIKIADNVDSLKVGDRVSIAWMYAACGNCEYCTTGRETLCRDVLNAGYTVDGAMAEE
VIVDANYAVKVPENLDPAAASSITCAGVTTYKAVKVSGIEPGQWLGVFGVGGLGNLALQY
AKNVMGAKVVAFDINDDKLNFAKELGADAIINSTNVDPIEEVNRLTNNKGLDATVITAVA
KTPFNQAVDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIEVVGSLVGTRQDLREAFQFAA
ENKVIPKIQLRQLSEINDIFDEMEKGTITGRMVIDMKSTH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgtagtaaccaaagatcatagagtaagtattgaagaaaaacgtttaaga
gaattaagacctggagaagcattagtaaagactgaatattgtggtgtatgtcatactgat
ttacatgttaaaaatgcagatttcggtgacgtaacaggtgtaacattaggacatgaagga
attggacgtgtcattaaaattgctgataacgtagattcattaaaggtaggggatcgtgta
tctatagcatggatgtatgcagcatgtggtaattgtgagtattgcacaactggtagagaa
acattatgcagggatgtccttaatgccggatatactgttgatggggcaatggctgaagaa
gtcattgttgatgcgaattatgcagttaaagttcccgaaaatcttgatccagcggctgct
tcatctattacctgtgcaggtgtgacaacatataaagcagtaaaagtgagtggtatcgaa
ccaggacaatggttaggcgtatttggtgtgggaggattaggtaatttagcattgcaatac
gccaaaaacgtaatgggcgcgaaagtcgttgcatttgacattaatgatgataaattaaat
tttgctaaagagcttggtgctgatgcaatcataaattcaactaatgttgatcctattgag
gaagttaatcgtctaacgaataataaaggattagatgcaacggtgattactgctgtagct
aaaacaccttttaatcaagcagttgatgttgttaaggcgggtgcacgtgtggtagcagta
ggacttccagtagataaaatggatttagatattccacgtttagtgcttgatggaattgaa
gtcgttggttcattagttggtaccagacaagatttaagagaagcatttcaatttgctgcc
gaaaataaagttattcctaaaatccaattaagacaattatctgaaattaacgatattttt
gatgaaatggaaaaaggaacaattacgggtcgaatggtaattgatatgaaaagcacgcac
tga

DBGET integrated database retrieval system