KEGG   Staphylococcus epidermidis ATCC 12228: SE0559Help
Entry
SE0559            CDS       T00110                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00051  Fructose and mannose metabolism
sep00562  Inositol phosphate metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
sep01230  Biosynthesis of amino acids
Module
sep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sep_M00002  Glycolysis, core module involving three-carbon compounds
sep_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE0559 (tpiA)
   00051 Fructose and mannose metabolism
    SE0559 (tpiA)
   00562 Inositol phosphate metabolism
    SE0559 (tpiA)
Enzymes [BR:sep01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SE0559 (tpiA)
Exosome [BR:sep04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SE0559 (tpiA)
  Exosomal proteins of bladder cancer cells
   SE0559 (tpiA)
  Exosomal proteins of melanoma cells
   SE0559 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1057780
NCBI-ProteinID: NP_764114
UniProt: Q8CTD5
Position
555880..556641
Genome map
AA seq 253 aa AA seqDB search
MRTPIIAGNWKMNKTVQEAKDFVNELPTLPDPKEVESVICAPTIQLDALVTAVKDGKAKG
LKIGAQNAYFEESGAYTGETSPVALSELGVKYVVIGHSERRDYFHETDEEVNKKAHAIFN
HGMTPIICVGESDEEREAGKANKIVGNQVKKAVEGLSDDQLKEVVIAYEPIWAIGTGKSS
TSEDANEMCAHVRQTLADLSSQEVADATRIQYGGSVKPNNIKEYMAQSDIDGALVGGASL
KVEDFVQLLEGAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaccaattatagccggaaactggaaaatgaataaaacagttcaagaagctaaa
gactttgtaaacgaattaccaacattacctgatcctaaagaagtagaatcagttatttgt
gcaccaacaatccaattagacgctttagtaacagctgttaaagatggtaaagcaaaaggg
ttaaaaattggagcacaaaacgcttactttgaagaaagcggtgcttatactggagaaact
tcaccagtagcattatctgaattaggtgttaaatatgtagtgattggtcactcagagcgt
cgtgactatttccacgaaactgacgaagaagtaaacaaaaaagcgcatgctatcttcaat
cacggtatgacacctattatttgtgtaggtgaatctgatgaagaacgtgaagctggtaaa
gcaaataaaatcgtaggtaatcaagtgaaaaaagctgtcgaaggtttatcagatgatcaa
cttaaagaagttgttattgcatatgaaccaatttgggctatcggtactggtaagtcatct
acatctgaagatgcaaatgaaatgtgtgctcacgtacgtcaaacattagctgacttatct
agtcaagaggttgctgacgctacacgtattcaatatggtggtagtgttaaacctaataac
attaaagaatatatggctcaatcagatatcgatggcgctcttgtaggtggcgcatcatta
aaagttgaagatttcgtacaattgttagaaggtgcaaaataa

DBGET integrated database retrieval system