KEGG   Staphylococcus epidermidis ATCC 12228: SE0858Help
Entry
SE0858            CDS       T00110                                 

Gene name
murD
Definition
(RefSeq) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00471  D-Glutamine and D-glutamate metabolism
sep00550  Peptidoglycan biosynthesis
sep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SE0858 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE0858 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sep01011]
    SE0858 (murD)
Enzymes [BR:sep01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     SE0858 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:sep01011]
 Precursor biosynthesis
  Amino acid ligase
   SE0858 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_3 NAD_binding_7 2-Hacid_dh_C AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 1056211
NCBI-ProteinID: NP_764413
UniProt: Q8CSX6
Position
851321..852670
Genome map
AA seq 449 aa AA seqDB search
MLNYTELENKNVLVVGLAKSGYEAAKLLLKLGANVKVNDGKDLSQDAHAKDLESMGIEVI
SGSHPFSLLDDDPIIVKNPGIPYTVSIIKEATNRGLKILTEVELSYLISEAPIIAVTGTN
GKTTVTSLIGDMFQKSVLTGRLSGNIGYVASKVAQEVKSDEYLITELSSFQLLGIEEYKP
HIAIITNIYSAHLDYHETLENYQNAKKQIYKNQTKDDYLICNYHQRHLIESENLEAKTFY
FSTQQEVDGIYIKDGFIVFNGIRIINTKDLVLPGEHNLENILAAVLASIIAGVPVKAIVD
SLVTFSGIDHRLQYIGTNRTNKYYNDSKATNTLATQFALNSFDQPIIWLCGGLDRGNEFD
ELIPYMENVRVMVVFGETQDKFAKLGNSQGKYVIKATDVEDAVDKIQDIVEPNDVVLLSP
ACASWDQYHTFEERGEKFIDRFRAHLPSY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaattacactgaattagaaaataaaaatgttttagtagtaggcttagcaaaaagt
ggatatgaagcggcgaaacttctccttaaattaggggctaacgttaaagtcaatgatgga
aaggatctttcacaggatgcacatgctaaagatttagaatctatgggcattgaggtaatt
agcggtagtcatcctttttctttattagatgatgatcctatcattgtgaaaaacccaggt
attccatatactgtatcaattattaaagaagcaacaaatagagggcttaaaatcttaaca
gaggttgaacttagctatttaatttctgaggcaccaatcatagcagttactggaactaac
ggtaaaactactgtcacttcactaatcggtgatatgttccaaaaaagcgtgttgactgga
cgactttctgggaatattggttatgtagcctcaaaagttgcacaagaagttaaatcagat
gagtatttaataacagaattatcatcttttcaattattaggcattgaggaatataaacca
catatcgctatcattactaatatttattctgcacatttggattaccatgaaacgttagag
aactatcaaaatgctaaaaagcaaatatataaaaatcaaactaaagatgattatctcatt
tgtaattatcatcaaaggcacctaattgaatcagaaaatctagaagcgaaaacattttat
ttttcaacacagcaagaagttgatgggatatacattaaagatggtttcattgtttttaac
ggcattcgcattattaacactaaagacttagtgctaccgggagaacataacctggaaaat
attttagcagctgttctagcatcaatcattgctggagtgccagtcaaagctattgtagat
agtcttgttactttttccggtattgatcatagacttcagtatattggtacaaatcgcaca
aataaatattataatgattcaaaagcaactaatactttagctactcaatttgcgcttaac
tcttttgatcaaccaattatttggttgtgtggtggattagatcgtggtaatgaattcgat
gaacttattccttatatggaaaatgtacgtgtgatggttgtttttggagaaacacaagat
aaatttgctaaattgggaaatagtcaaggtaagtatgtgattaaagcaacagatgtagag
gatgctgttgataaaattcaagatatagtcgagcccaatgatgttgttctattatcacca
gcttgtgcaagttgggatcagtatcatacatttgaagaacgtggtgagaagtttatcgat
agattccgagcgcacttgccatcatactaa

DBGET integrated database retrieval system