KEGG   Staphylococcus epidermidis ATCC 12228: SE0923Help
Entry
SE0923            CDS       T00110                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00020  Citrate cycle (TCA cycle)
sep00640  Propanoate metabolism
sep00660  C5-Branched dibasic acid metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Module
sep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SE0923 (sucC)
   00640 Propanoate metabolism
    SE0923 (sucC)
   00660 C5-Branched dibasic acid metabolism
    SE0923 (sucC)
Enzymes [BR:sep01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SE0923 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind
Motif
Other DBs
NCBI-GeneID: 1057533
NCBI-ProteinID: NP_764478
UniProt: Q8CPH5
Position
922242..923408
Genome map
AA seq 388 aa AA seqDB search
MNIHEYQGKEIFRSMGVAVPEGRVAFTAEEAVEKAKELNSDVYVVKAQIHAGGRGKAGGV
KIAKSLSEVETYANELLGKQLVTHQTGPEGKEVKRLYIEEGCDIQKEYYVGFVIDRATDK
VTLMASEEGGTEIEEVAAQTPEKIFKETIDPVVGLSPYQARRIAFNINIPKESVGKATKF
LLALYNVFIEKDCSIVEINPLVTTGDGQVLALDAKLNFDDNALFRHKDILELRDLEEEDP
KEIEASKYDLSYIALDGDIGCMVNGAGLAMATMDTINHFGGNPANFLDVGGGATKEKVTE
AFKIILGDDNVKGIFVNIFGGIMKCDVIAEGIVAAVKEVELTLPLVVRLEGTNVERGKAI
LNESGLAIEPAATMAEGAQKIVKLVKEA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccacgagtatcaagggaaagaaatatttcgttcaatgggcgttgcagttcca
gagggacgagtagcatttactgctgaagaagcagtggaaaaagcgaaagaattaaattca
gacgtatatgtggttaaagcgcaaattcacgctgggggtagaggtaaagcaggcggcgtg
aaaattgctaaatcattatctgaagtcgaaacgtacgcaaatgaactgctaggtaaacaa
ttggtcacacatcaaactgggccagagggcaaagaggtcaaacgtttatatatcgaagaa
ggatgcgatatccaaaaagaatattatgttggttttgttattgatcgtgctactgataaa
gtgactttgatggcatcagaagaaggtggaactgaaattgaagaggttgcagctcaaaca
cctgaaaagattttcaaagaaacaattgatccagtagtaggattatcaccttaccaagcg
cgacgtatcgcttttaatattaacattccaaaagaatcagttggaaaagcaactaaattt
ttattagcactatataatgtctttatcgaaaaagattgttctattgttgaaattaaccca
cttgttacaactggagacggtcaggtattggctttagatgctaaattaaactttgatgat
aatgcattatttagacataaagatattttagaattacgagatttagaagaagaagatcct
aaggaaatagaagcttctaaatatgatttatcatacatcgctttagatggagatattggt
tgtatggttaatggcgcaggtttagccatggcaacaatggatacaattaatcattttggt
ggaaatccagccaacttcttagatgtaggtggcggtgctacaaaagaaaaggtaactgaa
gcatttaaaattattttaggtgatgacaatgttaaaggtatctttgtaaatatttttggt
ggaattatgaaatgtgatgttattgccgaaggtattgtagcagcggttaaagaagttgaa
ctaacattaccattagttgttcgtttagaaggaactaatgtcgaacgtggtaaagcaata
ttaaacgaatcaggtttagctattgagccagcagcaactatggctgaaggtgctcaaaaa
attgtgaaacttgttaaagaagcataa

DBGET integrated database retrieval system