KEGG   Staphylococcus epidermidis ATCC 12228: SE1010Help
Entry
SE1010            CDS       T00110                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00260  Glycine, serine and threonine metabolism
sep00750  Vitamin B6 metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01230  Biosynthesis of amino acids
Module
sep_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SE1010
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SE1010
Enzymes [BR:sep01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SE1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Peripla_BP_6 PK_C DUF4687
Motif
Other DBs
NCBI-GeneID: 1057323
NCBI-ProteinID: NP_764565
UniProt: A0A0H2VHK9
Position
1015492..1016556
Genome map
AA seq 354 aa AA seqDB search
MKRWQGLVKEFKEYLPVNQSTPALTLNEGHTPLIYCENLSQKLDIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGKKVVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEIAEENDEIELVNSVNPFRIEGQKTGAFEIVEQLDGQA
PDILAIPVGNAGNITAYWQGFVEYHNKKNTQLPQMFGFQAEGASPIVQNKIIKNPETIAT
AIRIGNPASWQKAVNALDESNGLIDSVTDEEILEAYQLMTTNEGVFSEPASNASIAGLIK
LHRSGKLPKGKKIVAILTGNGLKDPDTAISLLDNPIQPLPNNKESIIRYIKGAI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatggcaaggattagttaaagaatttaaagaatatttaccagtcaatcaatct
acaccagcactaacactcaatgaaggacatacaccacttatttattgtgaaaatctttct
caaaaattagatattgaattatatgttaaatatgaaggagcaaatccgactggctcattt
aaagatcgtggtatggttatggctgtaacaaaggcaaaagaacaagggaaaaaagttgtt
atttgtgcttccactggtaatacttcagcatcagcagctgcttatgctgcaagagctggt
ttaaaagcaattgtcgtaattcctgaaggtaaaatagcattaggtaaattatcacaagca
gttatgtatggtgcagaaattgtttctatagaaggaaacttcgatgaagcactagaaatt
gtaaaagagattgctgaagaaaatgatgaaattgaattagttaattctgttaatccattt
aggattgaaggacaaaagacgggtgcctttgaaattgttgaacagttagatggtcaagcc
cctgacattttagcaataccagtgggaaatgcaggtaatataactgcttattggcaagga
tttgttgaatatcataataaaaagaatacacaattaccacaaatgtttggcttccaagca
gaaggagcatctccaattgttcaaaataaaataatcaaaaatccagaaacaatagctaca
gctatccgaatagggaatcctgctagttggcaaaaagctgttaatgcactagatgaatca
aatggtttaattgatagtgtgacagatgaagaaattttagaagcttatcagttaatgaca
acaaatgaaggtgtttttagtgaaccagcgagtaatgcttcaattgcaggtctaatcaaa
cttcatcgctctggtaagttacctaaaggtaaaaagatagttgcaatattaactgggaat
ggacttaaagatcctgacacagctatttctctcttagataatcctattcaacctttacct
aataataaagaaagtataattagatacatcaaaggggcaatctag

DBGET integrated database retrieval system