KEGG   Staphylococcus epidermidis ATCC 12228: SE1233Help
Entry
SE1233            CDS       T00110                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00010  Glycolysis / Gluconeogenesis
sep00052  Galactose metabolism
sep00500  Starch and sucrose metabolism
sep00520  Amino sugar and nucleotide sugar metabolism
sep00521  Streptomycin biosynthesis
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
Module
sep_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sep_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SE1233
   00052 Galactose metabolism
    SE1233
   00500 Starch and sucrose metabolism
    SE1233
   00520 Amino sugar and nucleotide sugar metabolism
    SE1233
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SE1233
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SE1233
Enzymes [BR:sep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SE1233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Pan_kinase
Motif
Other DBs
NCBI-GeneID: 1056070
NCBI-ProteinID: NP_764788
UniProt: A0A0H2VIT7
Position
complement(1264107..1265093)
Genome map
AA seq 328 aa AA seqDB search
MTDIILAADIGGTTCKLGIFDKDLEQLHKWSIDTDTSDHTGELLLKNIYNSFTEKIAEYK
YDFNNVVGVGIGVPGPVDFDTGVVYGAVNLHWPDSVNVREIFKQYVNCPVYVDNDANVAA
LGEKHKGAGEGADDVVAITLGTGLGGGIISNGEIVHGHNGSGAEIGHLRADFDQRFQCNC
GKSGCIETVASATGVVNLVNFYYPKLTFKSSILQLIKDNQVTAKAVFDAAKAGDQFCIFI
TEKVANYIGYLCSIISVTSNPKYIVLGGGMSTAGLILIENIKTEYRNLTFTPAQNNTEIV
QAKLGNDAGITGAAGLIKTYIIDKEGAK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacagatattattttagctgctgatataggcggaacaacttgtaaattggggatattt
gacaaggatttagaacaattgcataaatggtctattgatactgatacaagtgaccacact
ggtgagttacttttaaaaaacatttataattcttttactgaaaagattgcagaatataaa
tatgattttaacaatgtagttggagtcggtattggtgttcctgggcctgttgattttgat
actggagttgtatacggagctgttaatttacattggcccgatagtgtcaatgtaagagaa
attttcaaacaatatgttaattgtccagtttatgttgataatgatgctaatgttgctgct
ttgggagaaaaacataaaggtgccggcgaaggtgctgatgatgtagtagccattacttta
ggtaccggcctaggtggaggtataatttctaatggagaaattgtacatggacacaatggg
tctggcgctgagattggacatttaagagctgattttgatcaacgttttcaatgcaattgt
ggtaaatcaggttgtatagaaacagttgcttctgctactggtgtagtaaatttagttaat
ttctattatcctaaattaacgtttaaatcatcaattttacaacttattaaagataaccaa
gtaactgcaaaagctgtatttgatgcggctaaagctggcgatcaattctgtatatttata
actgaaaaagtggcaaattatatcggttatttatgcagtatcattagcgttactagtaat
ccaaaatatattgttctaggagggggcatgtctacagcgggacttatccttatagaaaat
attaaaactgaataccgtaatttaacttttactccagctcaaaataatactgagatagta
caagctaagttagggaatgacgctggtattactggtgcagctgggcttatcaaaacatat
atcatagataaagagggtgctaaataa

DBGET integrated database retrieval system