KEGG   Staphylococcus epidermidis ATCC 12228: SE1342Help
Entry
SE1342            CDS       T00110                                 

Definition
(RefSeq) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00860  Porphyrin and chlorophyll metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SE1342
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sep01007]
    SE1342
Enzymes [BR:sep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SE1342
Amino acid related enzymes [BR:sep01007]
 Aminotransferase (transaminase)
  Class III
   SE1342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 1056309
NCBI-ProteinID: NP_764897
UniProt: Q8CNZ1
Position
complement(1371659..1372942)
Genome map
AA seq 427 aa AA seqDB search
MSFEKSIKAMEQAEKLMPGGVNSPVRAFKSVDTPAIFMDHGEGSKIYDIDGNEYIDYVLS
WGPLILGHKNQQVISKLHEAVDKGTSFGASTLQENKLAELVIDRVPSIEKVRMVSSGTEA
TLDTLRLARGYTGRNKIIKFEGCYHGHSDSLLIKAGSGVATLGLPDSPGVPEGIAKNTIT
VPYNDLDSLKLAFEKYGDDIAGVIVEPVAGNMGVVPPVNGFLQGLRDITNEYGALLIFDE
VMTGFRVGYNCAQGYFGVTPDLTCLGKVIGGGLPVGAFGGKKEIMDYIAPVGTIYQAGTL
SGNPLAMTSGYETLSQLTPESYEYFNSLGDILEKGLKEVFAKHNVPITVNRAGSMIGYFL
NEGPVTNFEEANKSDLKLFSNMYREMAKEGVFLPPSQFEGTFLSTAHTKDDIEKTIQAFD
NALSRIV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagttttgaaaaatctattaaagcaatggagcaagctgagaaattaatgcctggcggt
gttaacagtcccgtaagagcatttaaatcagtagacacaccagctatttttatggatcat
ggtgaaggatctaaaatatatgatattgatggaaatgaatacattgattatgtgctaagt
tggggcccattaattctgggacataaaaatcaacaagttatatccaaattacatgaagca
gtagataaaggtacaagcttcggcgcttcaacacttcaagaaaataaacttgctgaactt
gtgattgaccgtgtaccttcaattgaaaaagtaagaatggtttcctcaggaactgaagct
actttagacacacttcgtttagctaggggttatacaggacgtaataaaattataaaattt
gaagggtgttatcatggacacagtgattctttattgattaaagcaggatcaggtgttgca
acactaggtttacctgattcaccaggcgtccctgaaggtattgctaaaaacactatcacg
gtgccatataatgatttagattcacttaaattagcgttcgaaaaatatggcgatgatatt
gctggtgttattgttgaaccggttgctggaaatatgggtgtagtgcctccagtgaatgga
tttctacaaggtttaagagatattactaatgaatatggagcattacttatatttgatgaa
gtgatgactggtttccgtgtaggttataattgtgcgcaaggatactttggtgtaacacct
gatttaacttgcttaggaaaagtgataggtggaggtttacccgttggagcttttggtggt
aaaaaagaaattatggattacattgctcctgttgggactatttatcaagctggcacactt
tcaggtaatcctttagcaatgactagtggttatgaaacattgagtcaacttactcctgaa
tcttatgagtattttaattctctaggagatatacttgaaaaaggattaaaagaggtattt
gctaagcataatgttccaatcacagtaaatcgcgctggttcaatgattggttacttctta
aatgaggggcctgtaacaaattttgaggaagcaaataaaagtgatttaaaattatttagt
aatatgtatagagaaatggctaaggaaggtgttttcctaccaccttcacaatttgaagga
acatttttatcaactgcacatactaaagatgatattgagaaaactatccaagcatttgat
aatgcattaagtcgtattgtgtga

DBGET integrated database retrieval system