KEGG   Staphylococcus epidermidis ATCC 12228: SE1370Help
Entry
SE1370            CDS       T00110                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00020  Citrate cycle (TCA cycle)
sep00480  Glutathione metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
sep01120  Microbial metabolism in diverse environments
sep01130  Biosynthesis of antibiotics
sep01200  Carbon metabolism
sep01210  2-Oxocarboxylic acid metabolism
sep01230  Biosynthesis of amino acids
Module
sep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sep_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SE1370
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SE1370
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SE1370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 1058012
NCBI-ProteinID: NP_764925
UniProt: Q8CNX4
Position
complement(1401558..1402826)
Genome map
AA seq 422 aa AA seqDB search
MSAEKITQSKDGLNVPNEPIIPFIIGDGIGPDIWKAASRVIDAAVEKAYNGEKRIEWKEV
LAGQKAYDETGEWLPQETLETIKEYLIAVKGPLTTPIGGGIRSLNVALRQELDLFTCLRP
VRWFKGVPSPVKRPEDVDMVIFRENTEDIYAGIEFKQGTSEVKKVIDFLQNEMGATNIRF
PETSGIGIKPVSKEGTERLVRAAIQYALDNNRKSVTLVHKGNIMKFTEGSFKQWGYDLAH
NEFGDKVFTWQQYDEIVEQKGKDAANEAQSKAEQEGKIIIKDSIADIFLQQILTRPAEHD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLNKVNPSS
EILSSVLMLEHLGWQEAADKITDSIEATIASKIVTYDFARLMDGAKEVSTSDFADELIKN
IR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaaaaaataacacagagtaaagatggtttaaatgtacctaatgaacctatt
attccgtttattattggtgatggtattggaccagatatttggaaagcagctagccgagta
atcgatgctgctgttgaaaaagcgtataatggagaaaaacgtatagaatggaaagaagtc
ttagcaggtcaaaaagcttatgatgaaactggagaatggttgccacaagaaacgttagaa
acaatcaaagaatatttaattgctgttaaaggtcctttaacaactccaattggtggtgga
attcgttcattaaacgtagcactgagacaagagttagatttattcacttgtttacgtccg
gtacgttggttcaaaggcgttccttcaccagttaagcgacctgaagatgttgatatggtt
attttccgtgaaaataccgaagatatatatgcagggatagaatttaaacaaggtacatca
gaagtaaaaaaagttatagatttcttacaaaatgaaatgggagcaactaatattcgtttc
cctgaaacttctggtattggtataaagccagtatctaaagaaggtacagaacgtctagta
agagcagctattcaatatgcacttgataataatcgtaaatcagtaactttagttcataaa
ggtaatattatgaaatttactgaaggttcatttaagcagtggggctatgatttagctcat
aatgaatttggtgataaagtgtttacatggcaacaatatgatgaaattgttgaacaaaag
ggtaaagatgctgcgaatgaagcacaaagtaaagctgaacaagaaggtaaaattattatt
aaagactctattgctgatatcttcttacaacaaatattaactcgtccagctgaacatgat
gttgtggcaactatgaatttaaatggtgactatatctctgatgctcttgcagctcaagtt
ggaggcattggtattgcgcctggtgctaacattaactatgaaactggacatgctattttt
gaagcaacacatggtactgcacctaaatatgctggtttaaataaggttaatccgtcatca
gaaattttaagttcagttttaatgcttgaacatttaggttggcaagaagccgcagataaa
atcactgactctattgaggcaacaattgcttcaaaaatcgtaacatatgattttgcgcgt
cttatggatggtgcaaaagaagtttcaacatctgattttgctgatgaactaattaagaat
attagataa

DBGET integrated database retrieval system