KEGG   Staphylococcus epidermidis ATCC 12228: SE1511Help
Entry
SE1511            CDS       T00110                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00860  Porphyrin and chlorophyll metabolism
sep01100  Metabolic pathways
sep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SE1511
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SE1511
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     SE1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO MCRA Thi4 Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_9 FMO-like FAD_binding_2 Mqo Semialdhyde_dh Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 1056727
NCBI-ProteinID: NP_765066
UniProt: A0A0H2VGX4
Position
complement(1559797..1561245)
Genome map
AA seq 482 aa AA seqDB search
MAYFNKFLSNSERKRGKVSKKVAIIGAGITGLSSAYFIKKQDPSIEVTIFEASNRVGGKI
QTYRSDGYTIELGPESYLGRKTIMTDVAKDIGLENDLITNTTGQSYIFAKNKLYPIPGGS
IMGIPTDIKPFIKTRLISPIGKLRAGLDLFKKPIEIEDDISVGSFFRQRLGNEVLENLIE
PLMGGIYGTDIDQLSLMSTFPNFKEKEEQFGSLIKGMKDEKEQRIKKRQLYPGAPKGQFK
QFRHGLSSFIEALVKDIESKGVHIRYNTPVKDILISQKDYEILLEDDSKEKFNGLLVTTP
HQVFMNWFSHDPAFDYFKNMDSTTVATVVLAFDEKNITNTYDGTGFVIARTSQTDITACT
WTSKKWPFTTPEGKVLIRAYIGKPGDTVVDDHTDEEIVSIVRKDLSQMMTISGNPDFTIV
NRLPKSMPQYHVGHIKMIKEIQQHIKTTYPRLRVTGAPFEAVGLPDCIQQGKNAVDEILE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgtattttaataaatttttaagcaattctgaaaggaagcgtggaaaagtgagtaag
aaagtggcaattattggagcgggaatcactggtttatctagcgcatatttcattaaaaaa
caagacccttctattgaagtaactatcttcgaagcctcaaatagagtaggtggaaagatt
caaacatatagatcagatggttacacaattgagttaggccctgagtcttatttaggtcgt
aagacaattatgactgatgtggcaaaagatattggattagaaaatgaccttataacaaat
actactggccaatcttatatttttgctaaaaataaattatatcctattcctggtggctca
attatgggaattcctacagatattaaaccatttattaaaacaagactcatttcacctatt
ggtaaattaagagcggggcttgatttgtttaaaaaaccgatagaaattgaagatgatatt
tctgttggtagtttctttagacaacgattaggtaatgaagtattagagaacttaattgaa
ccactaatgggtggtatttatggcactgatattgatcaattgagcttaatgagtacattt
cctaactttaaagaaaaagaggaacaatttggtagtttgattaaaggaatgaaagatgaa
aaagaacaacgtattaaaaaacgtcaattatatccaggtgctcctaaaggacaattcaaa
cagtttagacacggattgagttcttttatagaggctcttgttaaagatattgaaagtaaa
ggtgtccacatacgatataacacgccagtcaaagatatattgatttcgcaaaaagattat
gaaattttattagaagatgacagcaaagagaaatttaatggcttacttgtaacaacgcca
catcaagtatttatgaattggtttagtcacgatcctgcatttgattactttaagaacatg
gattctactactgtcgcaacagttgttttggcctttgatgagaaaaatattaccaatacg
tacgatggaactggctttgttattgcaagaacaagtcaaacggatattactgcatgtact
tggacatcaaagaaatggccatttactactccagaaggtaaagttttaattcgagcatat
ataggaaaaccaggtgatactgtagtagatgatcacaccgatgaagaaatagtatcaatt
gttagaaaagacttaagccaaatgatgaccatctcagggaatcctgattttacaattgta
aatcggttacctaagagtatgccccaataccacgtgggtcatattaaaatgattaaagaa
attcaacaacatattaaaacaacttatcctagattacgtgttacaggggcaccgtttgaa
gctgttggtttaccagactgcatacaacaaggtaagaatgcagttgatgaaatattagaa
gagttataa

DBGET integrated database retrieval system