KEGG   Staphylococcus epidermidis ATCC 12228: SE2019Help
Entry
SE2019            CDS       T00110                                 

Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SE2019
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     SE2019
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     SE2019
    1.1.1.-  
     SE2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N Lyase_1
Motif
Other DBs
NCBI-GeneID: 1057784
NCBI-ProteinID: NP_765574
UniProt: A0A0H2VI16
Position
2057653..2058705
Genome map
AA seq 350 aa AA seqDB search
MKAAVWYGQKDVRVEDREPKAIKDNEVQVKVSWAGICGTDLHEYLEGPIFISTDQPDPLL
GQTAPVTLGHEFSGVIENVGKDVSRFKKGDRVVVNPTVSKREKPENVDLYDGYSFIGLGS
DGAFAEFTNAPETNVYHLPDNVSAREGALVEPTAVAVQAVKEGELLFGDTVAVFGAGPIG
LLTIVAAKAAGASKIFVFDLSEERLAKAKSVGATHVYNSGNVDPVQTVYEHTDNGVDVSF
EVAGVGITLQQSIEVTRPRGTAVIVSIFGHPVEFNPLLQMNKGVKLTTTIAYTPTTFQQT
IDLIANGSLNVKDVVTDQIELENIVESGFNQLVNDKSQAKILVRLNGDQK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggacaaaaggatgtacgcgttgaagatcgcgaacccaaa
gcaataaaagacaatgaagtgcaagttaaagtctcttgggccggtatctgtggtactgat
ttacatgaatatttggaaggacctatctttatttcaactgatcaaccggacccactactt
ggtcaaactgcacctgtgactttaggtcatgaattttcaggtgtcatagaaaatgttggt
aaagacgtatcacgttttaaaaaaggggatcgtgtggtagttaatccaacagtgtctaaa
agagaaaagccggaaaatgttgacttgtatgatggttattcatttataggactaggttct
gatggtgcatttgccgagtttactaatgctcctgaaacaaatgtttatcatctaccagat
aatgtttcagcacgagaaggtgctcttgtagaaccaacagccgttgctgtccaagcagtt
aaagaaggcgaattattattcggtgatactgtagcagtatttggcgctgggccaattggt
ttgttaactattgttgcagcaaaagctgctggtgcaagtaaaatatttgtctttgactta
tcagaagaacgtttagcgaaagctaaaagtgtcggtgcgactcacgtgtataactcaggt
aacgtcgatccagtacaaacggtttatgaacacactgacaacggtgtagatgtgtcattt
gaagttgctggtgtaggtattactttacaacaatctattgaagtaacacgtccgcgtggt
actgctgtcatcgtatcaatcttcggtcatcccgtagaattcaatccattattacaaatg
aataaaggtgtcaagttaacaactacaattgcttatacaccaactacattccaacaaaca
atagatttaatcgctaacggtagcttaaatgttaaagacgtcgtaacagatcaaattgaa
ttagagaatattgttgaaagtggcttcaatcaacttgtaaacgataaatctcaagctaaa
attttagtccgtttaaatggcgaccaaaaataa

DBGET integrated database retrieval system