KEGG   Staphylococcus epidermidis ATCC 12228: SE2183Help
Entry
SE2183            CDS       T00110                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sep  Staphylococcus epidermidis ATCC 12228
Pathway
sep00480  Glutathione metabolism
sep00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sep00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SE2183
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SE2183
Enzymes [BR:sep01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SE2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 1056386
NCBI-ProteinID: NP_765738
UniProt: A0A0H2VIF6
Position
complement(2234563..2235039)
Genome map
AA seq 158 aa AA seqDB search
MSIYDIAVENYDGSTYLLKRYKGKVLIIVNTATNCTLNDQFNKLEMLYKKYHKYGLEILS
FPCNDFNNQEPELIKDIYRVYKYKFGITFPIHAKINVNGEHEHPLYTLLKCKQPGLFGSQ
IKWNFTKFVVDQQGNIVKRFLPCDNPNQMEKLIRQLLK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttatgatattgcggtagagaattatgatggctctacctatttactaaaaaga
tataaagggaaagtgctcattatcgtaaatactgcaacgaattgtactctgaatgatcaa
tttaataaattagaaatgctttataaaaaatatcataagtatggtcttgaaattttgagc
ttcccttgcaatgattttaataatcaggagccagaattaatcaaagatatttatcgagta
tataaatataagtttggtattactttccccatccatgctaagattaatgttaatggagag
catgaacaccctttgtacacattattaaaatgtaaacaaccaggattatttggttcgcaa
attaaatggaattttactaaatttgtagtagatcaacagggaaatattgttaaacgattt
ttaccttgtgataatcctaaccaaatggaaaaattaataagacaattattaaaataa

DBGET integrated database retrieval system