KEGG   Staphylococcus epidermidis PM221: SEB_00160Help
Entry
SEB_00160         CDS       T03289                                 

Definition
(GenBank) Glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00561  Glycerolipid metabolism
sepp00640  Propanoate metabolism
sepp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SEB_00160
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SEB_00160
Enzymes [BR:sepp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SEB_00160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 PFK PrpR_N ANF_receptor AIRC DUF4258
Motif
Other DBs
NCBI-ProteinID: CDM12726
Position
167479..168582
Genome map
AA seq 367 aa AA seqDB search
MSKFIYQSPGRYVQGKGIVSSIAEETERLGSHALIIADEVVWNITEEKIKESFSANNNVD
FEYEVFKGESSEEEIQRIVKQYKEKNIDVVIGLGGGKALDTGKAVAFELKASVIDFASTA
SMDAPTAAVSVIYNEDGSFSGYEFYPKNPDTVIVDSEIVAQAPVRLFASGMSDGLATLIE
VESTLRRQGQNMFHGKPTLASLAIAQKCEEVIFEYGYSAYTSVEKHIVTPQVDAVIEANT
LLSGLGFENGGLAGAHAIHNGFTALEGDIHHLTHGEKVAYGILVQLVLENAPTEKFMKYK
TFFDNINMPTTLEGLHIENTSYEELVQVGERALTPNDTFANLSDKITADEIADAILTVND
LSKSQFN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatttatttatcaatcaccaggaagatatgtacaagggaaaggtattgttagc
tctatcgctgaagaaacagaacgtcttggtagtcacgcgttgattattgcagatgaagtg
gtttggaatatcactgaagaaaaaataaaagaaagtttctcagcaaataacaacgttgat
tttgaatatgaagtatttaaaggagaatcttctgaagaagaaattcaacgtatagttaaa
caatataaagaaaaaaacattgacgttgttattggtttaggcggaggtaaagcgttagat
acaggtaaagctgtagcatttgaacttaaagcaagcgtcatcgattttgcgtctacagca
tcaatggatgcaccaacagcagcagtatctgttatttataacgaagatggatcatttagt
ggttatgaattctaccctaaaaaccctgatacagttatcgtagattctgaaattgttgca
caagcacctgtacgtttatttgcatcaggtatgagtgatggtttagcaacattaatcgaa
gttgaatctacacttcgtagacaagggcaaaacatgttccatggcaaacctacattagca
agtttagcaatcgctcaaaaatgtgaagaggttatttttgaatatggttacagtgcttat
acttctgtagaaaaacatatcgtgacaccacaagtagatgctgtgattgaagccaataca
ttactttcaggtttaggatttgaaaacggcggattagcaggtgcacacgcaattcataat
ggattcacagctttagaaggagatatccaccacttaactcatggtgaaaaagtggcatac
ggtattttagtacaattagtacttgaaaatgcgccaactgaaaaattcatgaaatacaaa
acattcttcgataatatcaatatgccaacaacattagaaggtcttcacattgaaaacaca
agttatgaagaattagttcaagtaggtgaacgtgcattaacaccaaatgatacgtttgct
aacttaagtgataaaatcactgctgatgaaatcgcagacgcaattttaactgttaatgat
ttatctaaaagtcagttcaactaa

DBGET integrated database retrieval system