KEGG   Staphylococcus epidermidis PM221: SEB_00633Help
Entry
SEB_00633         CDS       T03289                                 

Definition
(GenBank) Acetylornithine aminotransferase 2
  KO
K00819  ornithine--oxo-acid transaminase [EC:2.6.1.13]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00330  Arginine and proline metabolism
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SEB_00633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sepp01007]
    SEB_00633
Enzymes [BR:sepp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.13  ornithine aminotransferase
     SEB_00633
Amino acid related enzymes [BR:sepp01007]
 Aminotransferase (transaminase)
  Class III
   SEB_00633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CDM13194
Position
622000..623190
Genome map
AA seq 396 aa AA seqDB search
MTQSEKIINLTNHYGAHNYVPLPIVISEAEGVWVKDPEGNTYMDMLSAYSAVNQGHRHPR
IIQALKDQADKVTLVSRAFHSDNLGQWYEKICKLAGKDKALPMNTGAEAVETALKAARRW
AYDVKGIEPNKAEIIAFNGNFHGRTMAPVSLSSEAEYQRGYGPLLDGFRKVEFGDVNQLK
AAINKNTAAILVEPIQGEAGINVPPEGYLKTIRELCDEHQILFIADEIQAGLGRSGKLFA
TDWDHVKPDVYILGKALGGGVFPISVVLADNEVLDVFTPGSHGSTFGGNPLASAVSIAAI
DVIIDEDLPGRSLELGEYFKSELKKIEHPSIKEVRGRGLFIGIELHESARPYCEALKEQG
LLCKETHDTVIRFAPPLVITKEELDMALEKIKSVFA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgactcaatctgaaaaaattattaacttaacaaatcactatggggcgcataactacgtt
ccacttccaattgttatttctgaagcagagggtgtatgggtgaaagatccggaaggtaac
acgtatatggatatgctttcggcctactcggcagtgaatcaaggtcatcgacacccaaga
attattcaagcattgaaagatcaagcagataaagtcactttagtatcacgtgcttttcat
agtgataatttgggtcaatggtatgagaaaatatgtaaactcgcaggtaaagacaaagca
ttgcctatgaatacgggagcagaggcggttgaaacagctttaaaagctgctcgtcgttgg
gcttatgatgttaagggtattgagccgaacaaagctgaaattatcgcttttaatggtaat
ttccatggacgtacgatggcaccagtatcattgtcttcagaagctgagtatcaacgaggc
tatggtccattgttagatggctttcgaaaagttgagtttggtgacgttaatcaattaaaa
gcagcaattaataaaaatacagcagcaattttagtagaacctatacagggagaagcaggg
attaacgtaccaccagaaggatatttgaaaacaattagagaattatgtgatgaacatcaa
attttatttattgctgatgaaattcaagcaggattaggacgttcaggaaaattatttgca
acggattgggatcatgtaaaaccggatgtttatattttaggaaaagcgttaggtggaggg
gtatttcctatctcggtagttcttgcagataatgaggtattagatgtatttactcctggc
tcacatggttctacatttggtggaaatccactagcgagtgcagtttctattgcagctata
gatgtcattattgacgaggatttacctggtcgttcattagaattaggagaatattttaag
tctgaattgaaaaaaattgagcatccatctattaaagaagttaggggacgaggattattt
atcggtattgaattacatgaaagtgccagaccatattgtgaagctttgaaagaacaagga
ttattatgtaaagaaactcacgacaccgttattagatttgcacctccattagtgataacg
aaagaagagttagacatggctttagagaagattaagagtgtatttgcatag

DBGET integrated database retrieval system