KEGG   Staphylococcus epidermidis PM221: SEB_01144Help
Entry
SEB_01144         CDS       T03289                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00670  One carbon pool by folate
sepp00790  Folate biosynthesis
sepp01100  Metabolic pathways
Module
sepp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SEB_01144
   00670 One carbon pool by folate
    SEB_01144
Enzymes [BR:sepp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     SEB_01144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CDM13699
Position
complement(1146904..1147389)
Genome map
AA seq 161 aa AA seqDB search
MTLSIIVAHDKQRVIGYQNQLPWHLPNDLKHVKQLTTGNTLVMGRKTFNSIGKPLPNRRN
VVLTNQASFHHEGVDVINSLDEIKELSGHVFIFGGQTLFEAMIDQVDDMYITVIDGKFQG
DTFFPPYTFENWEVESSVEGQLDEKNTIPHTFLHLVRRKGK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacattatcaataattgtcgctcacgataaacaaagagtcattgggtaccaaaatcaa
ttaccttggcacttaccaaatgatttaaagcatgttaaacaactgaccactgggaataca
cttgtaatgggacggaaaacttttaattctatagggaaaccattgccaaatagacgtaac
gtcgtactcactaaccaagcttcatttcaccatgaaggggtagatgttataaactctctt
gatgaaattaaagagttatctggtcatgtttttatatttggaggacaaacgttattcgag
gcaatgattgaccaggtagatgatatgtatatcacagtaatagatggaaagtttcaagga
gacacattctttccaccatacacattcgaaaactgggaagtcgaatcttcagtagaaggt
caactagatgaaaaaaatactataccgcatacattcttacatttagtgcgtagaaaaggg
aaatag

DBGET integrated database retrieval system