KEGG   Staphylococcus epidermidis PM221: SEB_01180Help
Entry
SEB_01180         CDS       T03289                                 

Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00230  Purine metabolism
sepp00240  Pyrimidine metabolism
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
sepp01130  Biosynthesis of antibiotics
Module
sepp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
sepp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
sepp_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SEB_01180
   00240 Pyrimidine metabolism
    SEB_01180
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sepp04131]
    SEB_01180
Enzymes [BR:sepp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SEB_01180
Membrane trafficking [BR:sepp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SEB_01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CDM13735
Position
complement(1213127..1213576)
Genome map
AA seq 149 aa AA seqDB search
MERTFLMIKPDAVQRNLIGEIISRIEKKGLKLVGGKFMQVPMELAEKHYSEHEGKPFYDK
LISFITSAPVFAMVVEGENAVAVSRKIIGSTNPSEAAPGTIRGDYGLNLGRNIIHGSDST
ESAQREVKLWFTSSEIADYKEPREDWLYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtggaacgcacatttttgatgattaaaccggacgctgtccaaagaaatttaattggtgag
attatatctcgcattgaaaagaaaggtcttaagcttgttggcggtaagtttatgcaagtg
cctatggaactagctgaaaaacattatagtgaacatgaaggaaaaccgttctacgacaag
ttaatttcattcattacttctgcacccgtttttgctatggtagtagaaggtgaaaatgct
gtagctgtatctcgtaaaattattggaagcacaaatccaagcgaagcagctcctggtaca
atccgaggcgactatggtttaaatctaggtcgtaatattatacatggttcagattcaaca
gaatcagcacaacgtgaagttaaattatggtttacaagtagcgaaattgctgattataaa
gaaccaagagaagattggctatacgaataa

DBGET integrated database retrieval system