KEGG   Staphylococcus epidermidis PM221: SEB_01394Help
Entry
SEB_01394         CDS       T03289                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00020  Citrate cycle (TCA cycle)
sepp00480  Glutathione metabolism
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
sepp01120  Microbial metabolism in diverse environments
sepp01130  Biosynthesis of antibiotics
sepp01200  Carbon metabolism
sepp01210  2-Oxocarboxylic acid metabolism
sepp01230  Biosynthesis of amino acids
Module
sepp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sepp_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SEB_01394
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SEB_01394
Enzymes [BR:sepp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SEB_01394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: CDM13944
Position
complement(1421137..1422405)
Genome map
AA seq 422 aa AA seqDB search
MSAEKITQSKDGLNVPNEPIIPFIIGDGIGPDIWKAASRVIDAAVEKAYNGEKRIEWKEV
LAGQKAYDETGEWLPQETLETIKEYLIAVKGPLTTPIGGGIRSLNVALRQELDLFTCLRP
VRWFKGVPSPVKRPEDVDMVIFRENTEDIYAGIEFKQGTSEVKKVIDFLQNEMGATNIRF
PETSGIGIKPVSKEGTERLVRAAIQYALDNNRKSVTLVHKGNIMKFTEGSFKQWGYDLAH
NEFGDKVFTWQQYDEIVEQKGKDAANEAQSKAEQEGKIIIKDSIADIFLQQILTRPAEHD
VVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLNKVNPSS
EILSSVLMLEHLGWQEAADKITDSIEATIASKIVTYDFARLMDGAKEVSTSDFADELIKN
IR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagaaaaaataacacagagtaaagatggtttaaatgtacctaatgaacctatt
attccgtttattattggtgatggtattggaccagatatttggaaagcagctagccgagta
atcgatgctgctgttgaaaaagcgtataatggagaaaaacgtatagaatggaaagaagtc
ttagcaggtcaaaaagcttatgatgaaactggagaatggttgccacaagaaacgttagaa
acaatcaaagaatatttaattgctgttaaaggtcctttaacaactccaattggtggtgga
attcgttcattaaacgtagcactgagacaagagttagatttattcacttgtttacgtccg
gtacgttggttcaaaggcgttccttcaccagttaagcgacctgaagatgttgatatggtt
attttccgtgaaaataccgaagatatatatgcagggatagaatttaaacaaggtacatca
gaagtaaaaaaagttatagatttcttacaaaatgaaatgggagcaactaatattcgtttc
cctgaaacttctggtattggtataaagccagtatctaaagaaggtacagaacgtctagta
agagcagctattcaatatgcacttgataataatcgtaaatcagtaactttagttcataaa
ggtaatattatgaaatttactgaaggttcatttaagcagtggggctatgatttagctcat
aatgaatttggtgataaagtgtttacatggcaacaatatgatgaaattgttgaacaaaag
ggtaaagatgctgcgaatgaagcacaaagtaaagctgaacaagaaggtaaaattattatt
aaagactctattgctgatatcttcttacaacaaatattaactcgtccagctgaacatgat
gttgtggcaactatgaatttaaatggtgactatatctctgatgctcttgcagctcaagtt
ggaggcattggtattgcgcctggtgctaacattaactatgaaactggacatgctattttt
gaagcaacacatggtactgcacctaaatatgctggtttaaataaggttaatccgtcatca
gaaattttaagttcagttttaatgcttgaacatttaggttggcaagaagccgcagataaa
atcactgactctattgaggcaacaattgcttcaaaaatcgtaacatatgattttgcgcgt
cttatggatggtgcaaaagaagtttcaacatctgattttgctgatgaactaattaagaat
attagataa

DBGET integrated database retrieval system