KEGG   Staphylococcus epidermidis PM221: SEB_01704Help
Entry
SEB_01704         CDS       T03289                                 

Definition
(GenBank) Thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00730  Thiamine metabolism
sepp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SEB_01704
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sepp03000]
    SEB_01704
Enzymes [BR:sepp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     SEB_01704
Transcription factors [BR:sepp03000]
 Prokaryotic Type
  Other transcription factors
   Others
    SEB_01704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: CDM14242
Structure
PDB: 

Position
complement(1745101..1745790)
Genome map
AA seq 229 aa AA seqDB search
MTFSKELREASRPIIDDIYNDGFIQDLLAGKLSNQAVRQYLRADASYLKEFTNIYAMLIP
KMSSMEDVKFLVEQIEFMLEGEVEAHEVLADFINEPYEEIVKEKVWPPSGDHYIKHMYFN
AFARENAAFTIAAMAPCPYVYAVIGKRAMEDPKLNKESVTSKWFQFYSTEMDELVDVFDQ
LMDRLTKHCSETEKKEIKENFLQSTIHERHFFNMAYINEKWEYGGNNNE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcaaaagagttgagggaagcatcaagacctattattgatgacatttacaat
gatggttttattcaagatttactagcaggtaagttatctaatcaagcagtaagacaatac
ttaagagcagacgcttcttatttaaaagagtttacaaatatttatgcaatgctcataccc
aaaatgagttctatggaagatgttaaatttctagtagaacaaattgagtttatgttagaa
ggagaagttgaagcgcatgaggttctagctgatttcattaatgaaccatatgaagaaata
gtaaaagaaaaagtatggccaccaagtggtgatcattatattaaacatatgtacttcaat
gcatttgcacgtgaaaatgcagccttcacgattgcagcgatggcaccctgtccatacgtc
tacgctgtcattggtaaacgtgcgatggaagatcccaaattaaataaagaatcagtgact
tctaaatggtttcaattttatagtactgaaatggacgaacttgttgatgtgttcgatcaa
ttgatggaccgtttaactaaacattgtagtgagacagaaaaaaaagagattaaagaaaat
ttcttgcaaagtactattcatgagagacatttcttcaatatggcatatattaatgaaaaa
tgggaatatgggggaaataacaatgaataa

DBGET integrated database retrieval system