KEGG   Staphylococcus epidermidis PM221: SEB_02114Help
Entry
SEB_02114         CDS       T03289                                 

Definition
(GenBank) Hydroxymethylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00900  Terpenoid backbone biosynthesis
sepp01110  Biosynthesis of secondary metabolites
sepp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEB_02114
Enzymes [BR:sepp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     SEB_02114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red FbpC_C_terminal DUF1290
Motif
Other DBs
NCBI-ProteinID: CDM14648
Position
complement(2154714..2155991)
Genome map
AA seq 425 aa AA seqDB search
MKSLDKGFRHLTRKDKLKKLVEYGWLDDENYEILLNHPLINEEVANSLIENVIGQGALPV
GLLPRIIVDDKEYVVPMMVEEPSVVAAASYGAKLVNQSGGFKTISSERLMIGQIVFDDVE
DTGTLANSIYQIESQIHQIADEAYPSIKARGGGYQRIEIDTFPNHRLLSLKVFVDTKDAM
GANMLNTILEAITAHLKVKFSNQNVLMSILSNHATASVVKVQGEIDIEDLHRGERSGEEV
AQRMERASVLAQVDIHRAATHNKGVMNGIHAVVLATGNDTRGVEASAHAYASKDGHYRGI
ATWEYDRSRNKLVGTIEVPMTLATVGGGTKVLPIAKASLNLLNVENAQELGQVVAAVGLA
QNFSACRALVSEGIQQGHMSLQYKSLAIVVGAKGEEIAQVAEALKYESQANTAKAQEILM
NIRKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtttagataaaggatttagacatttaacacgaaaagataaattaaaaaaactt
gttgaatacggttggctagatgatgaaaactatgaaatattacttaatcatccgttaatt
aatgaggaagtcgcaaacagtttaattgaaaatgtcattggtcaaggtgcactaccagta
gggttattacctcgaattatagttgatgataaagaatatgtagtacctatgatggtagag
gaaccttctgtcgtagcagcagcaagttatggcgcaaaactcgttaatcaaagtggtgga
tttaagacaatttcaagtgaacgtctaatgattggacaaattgtctttgatgatgttgaa
gacacaggcacattagctaactcaatatatcaaatagaatcacaaattcatcaaatcgct
gatgaagcttacccttctattaaagcaagaggtggaggatatcaacgtattgaaatagat
acattccctaatcatcgattattatctttgaaggtttttgttgatactaaagatgctatg
ggtgctaatatgttaaatacaatattagaagcaatcactgcacatctaaaagttaaattt
tcaaatcaaaatgttttaatgagtattttatctaatcatgcgacagcatcagtagtaaaa
gtacaaggggaaatagatattgaagatttacatagaggagagagaagtggcgaagaggta
gcacaacgtatggaacgagcgtcagttcttgcacaagtagatatacatcgtgctgcaaca
cataacaaaggtgtgatgaatggtatacacgctgtagtattggctacaggcaatgataca
agaggagttgaagcaagtgctcatgcatatgcaagcaaagatggtcattatagagggata
gctacttgggaatatgatcgctcacgtaataaattggttggaactattgaagttcctatg
actttagcgacagtaggtggaggtacgaaagttttacctattgctaaagcctcattaaat
ttgcttaatgttgaaaatgcacaggaactagggcaagttgttgctgctgttggattagca
caaaatttctctgcatgtagagcgctagtgtctgaggggatacaacaaggacatatgagt
ttacaatataaatcattagcgattgttgtaggtgcaaaaggcgaagaaattgcgcaagta
gctgaagcgctcaaatatgaatcacaagctaatactgccaaagctcaagaaatcttgatg
aatataagaaagtcataa

DBGET integrated database retrieval system