KEGG   Staphylococcus epidermidis PM221: SEB_02379Help
Entry
SEB_02379         CDS       T03289                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase @ Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sepp  Staphylococcus epidermidis PM221
Pathway
sepp00071  Fatty acid degradation
sepp00072  Synthesis and degradation of ketone bodies
sepp00280  Valine, leucine and isoleucine degradation
sepp00310  Lysine degradation
sepp00362  Benzoate degradation
sepp00380  Tryptophan metabolism
sepp00620  Pyruvate metabolism
sepp00630  Glyoxylate and dicarboxylate metabolism
sepp00640  Propanoate metabolism
sepp00650  Butanoate metabolism
sepp00900  Terpenoid backbone biosynthesis
sepp01100  Metabolic pathways
sepp01110  Biosynthesis of secondary metabolites
sepp01120  Microbial metabolism in diverse environments
sepp01130  Biosynthesis of antibiotics
sepp01200  Carbon metabolism
sepp01212  Fatty acid metabolism
sepp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sepp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEB_02379
   00630 Glyoxylate and dicarboxylate metabolism
    SEB_02379
   00640 Propanoate metabolism
    SEB_02379
   00650 Butanoate metabolism
    SEB_02379
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SEB_02379
   00072 Synthesis and degradation of ketone bodies
    SEB_02379
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEB_02379
   00310 Lysine degradation
    SEB_02379
   00380 Tryptophan metabolism
    SEB_02379
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEB_02379
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEB_02379
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SEB_02379
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sepp04147]
    SEB_02379
Enzymes [BR:sepp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SEB_02379
Exosome [BR:sepp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SEB_02379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CDM14911
Position
complement(2462342..2463526)
Genome map
AA seq 394 aa AA seqDB search
MSRIVLAEAYRTPIGVFGGVFKDIPAYELGATVIRQILEHSQIDPNEINEVILGNVLQAG
QGQNPARIAAIHGGVPEAVPSFTVNKVCGSGLKAIQLAYQSIVAGDNEIVIAGGMESMSQ
SPMLLKNSRFGFKMGNQTLEDSMIADGLTDKFNDYHMGITAENLVEQYQISRKEQDQFAF
DSQQKASRAQQAGVFDAEIVPVEVPQRKGDPLIISQDEGIRPQTTIDKLAQLRPAFKKDG
SVTAGNASGINDGAAAMLVMTEDKAKALGLQPIAVLDSFGASGVAPSIMGIGPVEAIHKA
LKRSNKVINDVDIFELNEAFAAQSIAVNRELQLPQDKVNVNGGAIALGHPIGASGARTLV
SLLHQLSDAKPTGVASLCIGGGQGIATVVSKYEV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcatagtattagctgaagcatatcgaacacctataggcgtgtttggtggtgta
tttaaggatatacctgcctatgaactaggtgcaacagttattcgtcaaattttagaacat
agtcaaatagatcctaatgaaatcaatgaagttattctaggaaacgtattacaggcaggt
caaggacaaaatcctgctcgtattgctgcgattcatggtggtgtgccagaagcggtacct
tcttttactgtaaataaagtttgcggttctggattaaaagcgattcaacttgcctatcaa
tctattgtagcgggagataatgagattgttatcgctggaggcatggaaagtatgtctcaa
tctccaatgcttcttaaaaatagtcgtttcggttttaaaatgggaaatcaaactttagaa
gatagtatgatagctgatggtttaactgataagtttaatgattaccatatgggtatcaca
gccgaaaatctagttgaacagtatcagattagtcgtaaagaacaagatcaatttgcattc
gattctcaacaaaaagcatcacgtgcacaacaagctggtgtatttgatgctgaaattgta
cctgtagaggtaccacaacgtaaaggcgaccccctaattatttctcaagatgaaggcatt
agacctcaaacgacaattgataagttagcacaactccgtccagcatttaaaaaagatgga
tcagtaactgctggtaatgcatccggtatcaatgacggtgctgctgctatgctcgttatg
acggaggacaaagcgaaagcattgggcttacaacctatagctgtattagatagttttggt
gcgagtggtgtggcgccttcaattatgggtattggtccagttgaagcgatacataaagct
ttaaaacgttctaataaagtgataaatgatgttgatatttttgaattaaacgaagctttt
gcagcgcaatcaattgctgtaaaccgtgagttgcaattaccgcaagataaagtcaatgtt
aatggtggtgcgattgcactaggacatccgataggggcttcgggtgcgcgtactttagtt
tcattattacatcaattaagtgatgctaagccaacaggtgtggcatctttatgtatcggt
ggcggtcaaggtatcgctacggttgtatctaaatatgaagtttaa

DBGET integrated database retrieval system