KEGG   Staphylococcus epidermidis SEI: DP17_1435Help
Entry
DP17_1435         CDS       T03343                                 

Definition
(GenBank) putative acetyl-CoA acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seps  Staphylococcus epidermidis SEI
Pathway
seps00071  Fatty acid degradation
seps00072  Synthesis and degradation of ketone bodies
seps00280  Valine, leucine and isoleucine degradation
seps00310  Lysine degradation
seps00362  Benzoate degradation
seps00380  Tryptophan metabolism
seps00620  Pyruvate metabolism
seps00630  Glyoxylate and dicarboxylate metabolism
seps00640  Propanoate metabolism
seps00650  Butanoate metabolism
seps00900  Terpenoid backbone biosynthesis
seps01100  Metabolic pathways
seps01110  Biosynthesis of secondary metabolites
seps01120  Microbial metabolism in diverse environments
seps01130  Biosynthesis of antibiotics
seps01200  Carbon metabolism
seps01212  Fatty acid metabolism
seps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DP17_1435
   00630 Glyoxylate and dicarboxylate metabolism
    DP17_1435
   00640 Propanoate metabolism
    DP17_1435
   00650 Butanoate metabolism
    DP17_1435
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DP17_1435
   00072 Synthesis and degradation of ketone bodies
    DP17_1435
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DP17_1435
   00310 Lysine degradation
    DP17_1435
   00380 Tryptophan metabolism
    DP17_1435
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DP17_1435
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DP17_1435
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DP17_1435
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seps04147]
    DP17_1435
Enzymes [BR:seps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DP17_1435
Exosome [BR:seps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DP17_1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIR82609
Position
1522411..1523595
Genome map
AA seq 394 aa AA seqDB search
MSRIVLAEAYRTPIGVFGGAFKDIPAYELGATVIRQILEHSQIDPNEINEVILGNVLQAG
QGQNPARIAAIHGGVPEAVPSFTVNKVCGSGLKAIQLAYQSIVAGDNEIVIAGGMESMSQ
SPMLLKNSRFGFKMGNQTLEDSMIADGLTDKFNDYHMGITAENLVEQYQISRKEQDQFAF
DSQQKASRAQQAGVFDAEIVPVEVPQRKGAPLIISQDEGIRPQTTIDKLAQLRPAFKKDG
SVTAGNASGINDGAAAMLVMTEEKAKALGLQPIAVLDSFGASGVAPSIMGIGPVEAIRKA
LKRSNKVINDVDIFELNEAFAAQSIAVNRELQLPQDKVNVNGGAIALGHPIGASGARTLV
SLLHQLSDAKPTGVASLCIGGGQGIATVVSKYEV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcatagtattagctgaagcatatcgaacacctataggcgtgtttggtggtgca
tttaaggatatacctgcctatgaactaggtgcaacagttattcgtcaaattttagaacat
agtcaaatagatcctaatgaaatcaatgaagttattctaggaaacgtattacaggcaggt
caaggacaaaatcctgctcgtattgctgcgattcatggtggtgtgccagaagcggtacct
tcttttactgtaaataaagtttgcggttctggattaaaagcgattcaacttgcctatcaa
tctattgtagcgggagataatgagattgttatcgctggaggcatggaaagtatgtctcaa
tctccaatgcttcttaaaaatagtcgtttcggatttaaaatgggaaatcaaactttagaa
gatagtatgatagctgatggtttaactgataagtttaatgactaccatatgggcatcact
gccgaaaatctagttgaacagtatcagattagtcgtaaagaacaagatcaatttgcattc
gattctcaacaaaaagcatcacgtgcacaacaagctggtgtgtttgatgctgaaattgta
cctgtagaggtaccacaacgcaaaggcgcccccctaattatttctcaagatgaaggcatt
agacctcaaacgacaattgataagttagcacaactccgtccagcatttaaaaaagatgga
tcagtaactgctggtaatgcatccggtatcaatgacggtgctgctgctatgctcgttatg
acggaggaaaaagcgaaagcattgggcttacaacctatcgctgtattagatagttttggt
gcgagtggtgtggcgccttcaattatgggcattggtccagttgaagcgatacgtaaagct
ttaaaacgttctaataaagtgataaatgatgttgatatttttgaattaaacgaagctttt
gcagcgcaatcaattgctgtaaaccgtgagttgcaattaccgcaagataaagtcaatgtt
aatggtggtgcgattgcactaggacatccgataggggcttcaggtgcgcgtactttagtt
tcattattacatcaattaagtgatgctaagccaacaggtgtggcatctttatgtatcggt
ggcggtcaaggtatcgctacggttgtatctaaatatgaagtttaa

DBGET integrated database retrieval system