KEGG   Staphylococcus epidermidis SEI: DP17_964Help
Entry
DP17_964          CDS       T03343                                 

Definition
(GenBank) zinc-binding dehydrogenase family protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
seps  Staphylococcus epidermidis SEI
Pathway
seps00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:seps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DP17_964
Enzymes [BR:seps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     DP17_964
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     DP17_964
    1.1.1.-  
     DP17_964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc 2-Hacid_dh_C AlaDh_PNT_C UDPG_MGDP_dh_N Lyase_1
Motif
Other DBs
NCBI-ProteinID: AIR82355
UniProt: A0A2G7I109
Position
978015..979067
Genome map
AA seq 350 aa AA seqDB search
MKAAVWYGQKDVRVEDREPKAIKDNEVQVKVSWAGICGTDLHEYLEGPIFISTDQPDPLL
GQTAPVTLGHEFSGVIENVGKDVSRFKKGDRVVVNPTVSKREKPENVDLYDGYSFIGLGS
DGAFAEFTNAPETNVYHLPDNVSAREGALVEPTAVAVQAVKEGELLFGDTVAVFGAGPIG
LLTIVAAKAAGASKIFVFDLSEERLAKAKSVGATHVYNSGNVDPVQTVYEHTDNGVDVSF
EVAGVGITLQQSIEVTRPRGTAVIVSIFGHPVEFNPLLQMNKGVKLTTTIAYTPTTFQQT
IDLIANGSLNVKDVVTDQIELENIVESGFNQLVNDKSQAKILVRLNGDQK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcagtatggtatggacaaaaggatgtacgcgttgaagatcgcgaacccaaa
gcaataaaagacaatgaagtgcaagttaaagtctcttgggccggtatctgtggtactgat
ttacatgaatatttggaaggacctatctttatttcaactgatcaaccggacccactactt
ggtcaaactgcacctgtgactttaggtcatgaattttcaggtgtcatagaaaatgttggt
aaagacgtatcacgttttaaaaaaggggatcgtgtggtagttaatccaacagtgtctaaa
agagaaaagccggaaaatgttgacttgtatgatggttattcatttataggactaggttct
gatggtgcatttgccgagtttactaatgctcctgaaacaaatgtttatcatctaccagat
aatgtttcagcacgagaaggtgctcttgtagaaccaacagccgttgctgtccaagcagtt
aaagaaggcgaattattattcggtgatactgtagcagtatttggcgctgggccaattggt
ttgttaactattgttgcagcaaaagctgctggtgcaagtaaaatatttgtctttgactta
tcagaagaacgtttagcgaaagctaaaagtgtcggtgcgactcacgtgtataactcaggt
aacgtcgatccagtacaaacggtttatgaacacactgacaacggtgtagatgtgtcattt
gaagttgctggtgtaggtattactttacaacaatctattgaagtaacacgtccgcgtggt
actgctgtcatcgtatcaatcttcggtcatcccgtagaattcaatccattattacaaatg
aataaaggtgtcaagttaacaactacaattgcttatacaccaactacattccaacaaaca
atagatttaatcgctaacggtagcttaaatgttaaagacgtcgtaacagatcaaattgaa
ttagagaatattgttgaaagtggctttaatcaacttgtaaacgataaatctcaagctaaa
attttagtccgtttaaatggcgaccaaaaataa

DBGET integrated database retrieval system