KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_05190Help
Entry
SZO_05190         CDS       T00871                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00071  Fatty acid degradation
seq00072  Synthesis and degradation of ketone bodies
seq00280  Valine, leucine and isoleucine degradation
seq00310  Lysine degradation
seq00362  Benzoate degradation
seq00380  Tryptophan metabolism
seq00620  Pyruvate metabolism
seq00630  Glyoxylate and dicarboxylate metabolism
seq00640  Propanoate metabolism
seq00650  Butanoate metabolism
seq00900  Terpenoid backbone biosynthesis
seq01100  Metabolic pathways
seq01110  Biosynthesis of secondary metabolites
seq01120  Microbial metabolism in diverse environments
seq01130  Biosynthesis of antibiotics
seq01200  Carbon metabolism
seq01212  Fatty acid metabolism
seq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SZO_05190
   00630 Glyoxylate and dicarboxylate metabolism
    SZO_05190
   00640 Propanoate metabolism
    SZO_05190
   00650 Butanoate metabolism
    SZO_05190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SZO_05190
   00072 Synthesis and degradation of ketone bodies
    SZO_05190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SZO_05190
   00310 Lysine degradation
    SZO_05190
   00380 Tryptophan metabolism
    SZO_05190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SZO_05190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SZO_05190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SZO_05190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seq04147]
    SZO_05190
Enzymes [BR:seq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SZO_05190
Exosome [BR:seq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SZO_05190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: CAW98490
UniProt: C0MCF0
Position
601252..602442
Genome map
AA seq 396 aa AA seqDB search
MLVKEVVITTAVRTPIGSFGGAFKSVSAVQLGKVVVEALLEKSGVKPEQIDEVIFGNVLH
AGLGQNVARQVAITAGIPNDKPAFTVDMVCGSGLKSIELAAQSIVCGDSDIIIAGGTENM
SQASYVLKDYRWGGRLGDGKIIDTMVNDGLTDAFHDYHMGITAENIAKNYGISRKAQDIF
ALASQEKAAAAQAAGRFVDEIIPVPVPQRKGDPILVAEDEYIKAGTTLEKLTALRPAFVR
DGSGTVTAGNASGINDGAAAVLLMSRDKAEELGLPILGAIKGYASAGVAPEVMGTGPIPS
TQKALAKVGWTIEDLDLVEANEAFASQAISVVDELGLNADIVNVNGGAIALGHPIGASGA
RILVTLLHEMEKRQAHKGLATLCIGGGQGTSVLIEK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgttggttaaagaagttgttatcactacagctgttaggacacccattggttcatttggt
ggagcctttaaatctgtctcggctgttcaattaggaaaagtggttgtagaagcattacta
gagaaatcaggtgtgaagcctgaacaaattgacgaggtcattttcggaaatgtcctccat
gcaggactcggtcaaaatgttgctagacaggtagcgataactgcaggtattccaaacgac
aaacctgccttcactgtggatatggtctgtggttctggtctcaaatccatcgagttagca
gcacaaagtatcgtctgtggtgattcagatatcattattgcaggtgggacagaaaatatg
agccaagccagctatgtgctcaaagattaccgttggggtggtcgcttaggcgatggaaaa
atcattgatactatggtcaatgatggtttgacagatgcctttcatgattaccacatggga
attacagcagaaaatatcgcaaaaaactatgggattagccgtaaagctcaagatatattt
gctttggctagtcaggaaaaagctgctgctgcgcaggccgctggtcgctttgtagatgag
attattccagtgccagtaccgcaacgtaaaggtgatccaattttggtggcagaagatgag
tacattaaagctggaacaacccttgaaaaattaacagcccttcgtccggcctttgtccga
gatggttcaggaactgttactgcaggaaacgcttcaggaattaatgacggtgcggcagct
gtccttctcatgagtcgtgacaaagctgaagaacttggtcttccaattctgggagccatt
aaaggctatgcaagtgctggtgtagcaccagaggtcatgggtactgggccaattccttcc
actcagaaggcccttgctaaagttggttggacaattgaagacctggatttggtagaagcc
aatgaagcttttgcctcacaagctatcagtgtggtagatgagcttggtcttaatgcagat
atcgttaatgtcaatggtggtgctattgctcttggtcatccgatcggtgctagtggtgcg
cgtatcttggtaacactattgcacgagatggaaaagcgtcaggcgcataaaggattggca
acactttgcatcggtggcggtcaagggacatctgtattgattgaaaaataa

DBGET integrated database retrieval system