KEGG   Streptococcus equi subsp. zooepidemicus H70: SZO_15000Help
Entry
SZO_15000         CDS       T00871                                 

Definition
(GenBank) glycyl-tRNA synthetase beta chain
  KO
K01879  glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
seq  Streptococcus equi subsp. zooepidemicus H70
Pathway
seq00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:seq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SZO_15000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:seq01007]
    SZO_15000
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seq03016]
    SZO_15000
Enzymes [BR:seq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     SZO_15000
Amino acid related enzymes [BR:seq01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   SZO_15000
Transfer RNA biogenesis [BR:seq03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    SZO_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_synt_2f DALR_1
Motif
Other DBs
NCBI-ProteinID: CAX00162
UniProt: C0MDQ3
Position
complement(1684503..1686542)
Genome map
AA seq 679 aa AA seqDB search
MTKDLLVELGLEELPAYVVTPSEKQLVQRMADFLKDNRLSYDAIEGFSTPRRLAVRVLGL
ADQQTDLTEDFKGPSKKIALDADGQFSKAAQGFVRGKGLTVDDIEFREVKGEEYVYVTKH
EAGKQAKGVLAAVPEVLASLTFPVSMHWANNSFDYIRPVHSLIVLLDDEPLELDFLDIHS
GRISRGHRFLGEETSITSADSYEADLRSQFVIASAKERQEMIIAQIRAIEAEQKVQVDID
EDLLNEVLNLVEYPTAFMGSFDPKYLEIPEEVLVTSMKNHQRYFVVRDQAGKLMPNFISV
RNGNAKHLQNVIKGNEKVLVARLEDGEFFWREDQKLFIEDLVAKLAHVTFHEKIGSLAEH
MDRTKVIAAFLADQAGLSEAEKSAVARAAQIYKFDLLTGMVGEFDELQGIMGEKYALLAG
EAAAVATAIREHYLPDSAEGELPETKVGAVLALADKLDTLLSFFSVGLIPSGSNDPYALR
RATQGIVRILEHFGWSIPMDKLIDSLYELSFESLTYQHKAEVLDFICARVDKMMGSAIPK
DIREAVLASSSFVVPELLARAEALAAASQLDTYKPAVESLSRVFNLAKKAVDAVLIDASL
FENDYERALAQAVDSLVLSGSAKEQLAQVFALSPVIDDFFDHTMVMTEDEAIRCNRLALL
AELVKKVETIAAFDRLNTK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagatttacttgtagaacttggtcttgaagagcttcctgcctacgttgtcaca
cctagtgaaaagcagcttgtgcagcgtatggctgattttcttaaggacaatcggcttagc
tatgacgcaatcgaaggcttttcaacgccccgtcgtttagcagtgcgtgtgcttggatta
gctgatcagcagactgatctgacagaggattttaagggaccctctaaaaaaattgctctt
gacgctgatggtcaattttcaaaagccgctcagggctttgttcgtggaaagggcttgacc
gttgatgacatcgaattccgagaggtcaaaggcgaggaatacgtttatgtcaccaagcat
gaagcgggcaagcaggctaagggcgttttagcagcggtgcccgaggttcttgcttccttg
accttcccagtcagcatgcactgggctaacaacagctttgactatattcgtccggtgcat
agcttgattgtactgttagatgatgagcctttggagcttgactttttagacattcattcg
ggacgtatcagtcgcgggcatcgcttccttggagaagagactagcattacaagtgctgat
tcctatgaggctgatctgcgcagccaattcgtcattgcctctgctaaagagcgtcaagag
atgatcatagcacaaatcagagccatcgaagcagagcaaaaggttcaggtggatattgat
gaggacctcttaaatgaggtgctcaatctagtagaatacccaactgctttcatgggaagt
tttgatcccaagtacctggaaatcccagaagaggttctagtaacctcaatgaagaaccat
cagcgttattttgtcgtgcgtgatcaggctggcaagctaatgccgaattttatttctgtt
cgtaacggtaatgctaagcatcttcaaaatgtgattaagggcaatgaaaaggtgcttgtt
gctcgtcttgaagatggagaatttttctggcgtgaggaccaaaagctatttattgaggat
ttggttgctaagctagctcatgtgaccttccatgaaaagataggctctctggctgagcat
atggaccggaccaaggttattgcagcctttcttgctgaccaggctgggctctcagaagca
gaaaaaagtgctgttgctcgtgctgcccagatttataaatttgacctgctaactggtatg
gttggggaatttgatgagttgcagggcattatgggggagaaatacgcccttttagctggc
gaagctgctgctgtcgcaacagcaattcgtgagcattatttgccggattcggcagaagga
gagctgcctgaaacaaaggttggtgctgttcttgctcttgctgataagttagacaccctg
ctgtcctttttctctgttggtttgataccgtcaggatccaatgacccttatgccctacgt
cgtgcaactcaagggatcgtccgaattcttgagcatttcggctggagcattcctatggat
aagctgattgatagcctatatgagctgtcatttgagagcttgacctatcagcataaggct
gaggtgctggactttatttgtgcacgtgtggataaaatgatgggctcagccattccaaag
gatatacgtgaagcagttctggctagctcaagctttgttgtaccagaactgttagcaaga
gcggaggctctggctgcggcaagccagctagacacctacaagcctgctgtcgagtcgctg
tctcgcgtctttaatctagcgaaaaaggcagttgacgctgtgctgattgatgctagcctc
tttgaaaatgactacgaaagggctttggcacaggctgttgattcactagtgctatctgga
tcagccaaagaacagctagctcaggtctttgcccttagtccagttattgatgacttcttt
gaccatacgatggtcatgacagaggacgaagccattagatgtaaccgcttagcgctgtta
gcagagctggttaaaaaggtagagaccattgcggcctttgaccgattaaacactaaataa

DBGET integrated database retrieval system