KEGG   Staphylococcus equorum: SE1039_02460Help
Entry
SE1039_02460      CDS       T04160                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
seqo  Staphylococcus equorum
Pathway
seqo00450  Selenocompound metabolism
seqo00970  Aminoacyl-tRNA biosynthesis
seqo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seqo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SE1039_02460
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SE1039_02460
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:seqo01007]
    SE1039_02460
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seqo03016]
    SE1039_02460
Enzymes [BR:seqo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SE1039_02460
Amino acid related enzymes [BR:seqo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SE1039_02460
Transfer RNA biogenesis [BR:seqo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SE1039_02460
 Prokaryotic type
   Other AARSs
    SE1039_02460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 ARL2_Bind_BART PilM
Motif
Other DBs
NCBI-ProteinID: ALM56029
Position
271506..273491
Genome map
AA seq 661 aa AA seqDB search
MAKETFYITTPIYYPSGNLHIGHAYTTTAGDVIARYKRMQGYDVRYLTGTDEHGQKIQEK
AQKAGKSELEYLDEMIAGIKDLWNKLEISNDDFIRTTEARHKEVVQQIFERLLKQEDIYL
GEYEGWYSVPDETYYTETQLVDPIFENGEIVGGKSPDSGHEVELVKEESYFFNLSKYTDR
LLEFYDENPDFIQPPSRKNEMINNFIKPGLEDLAVSRTSFDWGIHVKSNPKHVVYVWIDA
LVNYISSLGYLSDDDSLFKKYWPADIHIMAKEIVRFHSIIWPILLMALDVPLPKKVFAHG
WILMKDGKMSKSKGNVVDPNVLIDRYGLDATRYYLMRELPFGSDGVFTPEGFVERTNYDL
ANDLGNLVNRTISMVNKYFDGELPAYQGPKHELDEDMEQMAIDTVNTFHENMDDLQFSVA
LSTVWKLISRTNKYIDETSPWVLAKDENQKDMLSNVMAHLVENIRIVAVLLRPFLTHAPK
QIFEQLNINSPELYEFDSVKQYGALTAPIVVSDKPQPIFPRLDSDAEIDYIKQSMQPETA
AEVSEETEEEVPSKSPIDIKDFDKVEIKAATITDAEQVKKSDKLLKIQVDLDSEHRQIVS
GIAKYYQPEDIIGKKVAVVTNLKPAKLMGRKSEGMILSAEKDGVLTLVSLPSAIPNGAII
K
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagaaacattttatatcactacaccaatatattatccaagtgggaatttacat
atcggtcatgcatatacaacaacagctggtgatgtaatcgcacgttataaaagaatgcaa
ggctatgatgttcgatatttaacaggtacggatgaacatggtcaaaaaatacaggaaaaa
gcacaaaaagctgggaaatctgaattagaatatttggatgaaatgattgctggaattaaa
gatttatggaataaattagaaatctcaaacgatgattttattcgtacaacagaagcgcga
cataaagaagtggtgcaacaaatatttgaacgtttattaaagcaagaggatatttatctt
ggcgaatatgaaggttggtattctgtaccagatgaaacttattatactgagacgcaatta
gtggatccgatatttgaaaatggtgaaatcgttggcggtaaaagtccagactctggtcac
gaagtagaattagttaaagaggaaagttatttcttcaatttatctaaatatacagaccgt
ttattagaattttacgatgaaaaccctgattttattcaaccaccttcacgtaaaaatgaa
atgattaacaatttcatcaaaccaggattagaagatttagcagtttcacgtacgtcattc
gattggggtatccatgtgaaatcaaatcctaaacacgtcgtttacgtgtggattgatgcg
cttgtgaactatatttcttcactaggttacttatcagatgatgatagcttattcaaaaaa
tattggccagcagatattcatatcatggcgaaggaaattgtgcgtttccactcaattatc
tggccaatcttgttgatggcattagatgttccacttcctaagaaagtctttgctcatggc
tggatacttatgaaagatggcaaaatgagtaaatctaaaggtaacgtggtcgatcctaat
gtacttatagatcgttatggtctagatgctacgcgttattatttaatgcgcgaattacca
tttggttcagatggtgtcttcacgcctgaaggtttcgttgaacgtacaaattatgattta
gcaaatgacttaggtaatttagtgaatcgtacaatttctatggtcaataaatattttgat
ggcgaattaccagcatatcaaggtccaaaacacgagttggatgaagatatggaacaaatg
gcgatagacacagtgaatacattccatgaaaatatggacgatttacaattctcagtagca
ctttcaacggtttggaagttaatcagtcgtactaataaatatattgacgaaacatcgccg
tgggtattagctaaagatgaaaatcaaaaagacatgctaagtaatgtaatggcgcattta
gtagaaaacattcgcattgtagcagtgttattaagaccattccttacgcacgcaccaaaa
caaatttttgaacagttgaatattaattcacctgaattatatgaatttgatagcgtgaaa
caatatggtgccttaactgcgccaatcgttgttagtgataaaccacaaccaatcttcccg
cgtttagatagtgatgcagaaatcgattatattaaacaatctatgcagccagaaacagcg
gcagaagtttcagaagaaactgaagaagaagtacctagtaagtcgccaatcgatatcaaa
gattttgataaagtagaaattaaagctgctacgattacagatgctgagcaagttaaaaaa
tctgataaattattgaaaatccaagttgatttagatagtgaacaccgtcaaatcgtctct
ggtattgcaaaatactatcaaccagaagatattataggtaaaaaagttgctgttgtaaca
aatttaaaacctgctaaattgatgggtagaaaatcagaaggtatgattttatctgctgaa
aaagatggcgtactgacacttgtaagtttaccaagcgcaattccaaatggtgcaataatt
aagtaa

DBGET integrated database retrieval system