KEGG   Staphylococcus equorum: SE1039_22210Help
Entry
SE1039_22210      CDS       T04160                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seqo  Staphylococcus equorum
Pathway
seqo00071  Fatty acid degradation
seqo00072  Synthesis and degradation of ketone bodies
seqo00280  Valine, leucine and isoleucine degradation
seqo00310  Lysine degradation
seqo00362  Benzoate degradation
seqo00380  Tryptophan metabolism
seqo00620  Pyruvate metabolism
seqo00630  Glyoxylate and dicarboxylate metabolism
seqo00640  Propanoate metabolism
seqo00650  Butanoate metabolism
seqo00900  Terpenoid backbone biosynthesis
seqo01100  Metabolic pathways
seqo01110  Biosynthesis of secondary metabolites
seqo01120  Microbial metabolism in diverse environments
seqo01130  Biosynthesis of antibiotics
seqo01200  Carbon metabolism
seqo01212  Fatty acid metabolism
seqo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seqo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SE1039_22210
   00630 Glyoxylate and dicarboxylate metabolism
    SE1039_22210
   00640 Propanoate metabolism
    SE1039_22210
   00650 Butanoate metabolism
    SE1039_22210
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SE1039_22210
   00072 Synthesis and degradation of ketone bodies
    SE1039_22210
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SE1039_22210
   00310 Lysine degradation
    SE1039_22210
   00380 Tryptophan metabolism
    SE1039_22210
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SE1039_22210
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SE1039_22210
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SE1039_22210
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:seqo04147]
    SE1039_22210
Enzymes [BR:seqo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SE1039_22210
Exosome [BR:seqo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SE1039_22210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALM58004
Position
complement(2307791..2308945)
Genome map
AA seq 384 aa AA seqDB search
MNKIAIVSAKRTPIGRFKGKLSNYSAVELGKKTLKAAIEAIKLDPNTIDQVIYGNVLQSG
SGQNPARQISINAGIPNTTPAMTINEVCGSGLKSIILGKQAIQLGEAKVVAVGGVESMTN
APQLILKEGESPVQSFMHDGLTDAFSNVPMGITAEKIAEKYDVTREQQDKFANDSHQKAH
QATEAGKFDNEIVPLKDVNGEWMTSDEGIRGNTSIEKLATLKTIFKENGTVTGGNASSIN
DGGSTIILMDAAYAKEQGYEILALLGEHAEIGCDPDYMGYAPYHAVTKLLDKTGKHIDDV
DVVEMTEAFASQSIPVRDNLGIAEEKLNLYGGAIALGHPIGATGTRLVTTLVNVLSQEDK
QSGIATACIGGGLGIALEIEKGHK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatagcaatcgtaagtgcaaaacgtacaccaattggaagatttaaagggaaa
ttaagtaattattcagcagttgaactcggaaagaaaacattaaaagcagcaatagaagca
attaaattagacccaaatacaatagatcaagtcatttatggcaatgtgttacaaagtgga
agcggacaaaacccagcgcgtcaaattagtatcaatgcaggtataccgaatacgacgcca
gctatgacgattaatgaagtttgtggttcaggattaaaatcaattattctcggtaaacaa
gcaatccaattgggagaagcgaaagtagttgcagttggtggcgtagaaagtatgacgaac
gcaccacaacttattttgaaagaaggagaatcacctgttcaaagctttatgcatgacggt
ttaacagatgctttttcaaatgtgccaatgggcatcacagcagaaaaaatagctgaaaaa
tacgatgtaacacgcgagcaacaagataaatttgcaaatgattctcatcaaaaagcacat
caagcgactgaagcgggcaaatttgataatgaaattgtacctttaaaagatgtaaatgga
gaatggatgacaagtgatgaaggtatacgtggcaatacgagtatagaaaagcttgcaact
ttaaaaacaatttttaaggaaaatggcacagttactggtggtaatgcatctagtattaat
gatggtggttcaactattatcttaatggacgcagcttatgcaaaagaacaaggctatgaa
attttagcgcttctaggagaacacgctgaaataggttgtgatcctgattatatgggatat
gcaccatatcatgcagttacgaaattattagataagacaggtaaacatattgatgacgta
gatgtagttgaaatgactgaagcatttgcatcacaaagtatccctgttcgagataattta
ggcatagctgaagagaaactcaatttatatggtggtgcgattgcgctaggtcacccaatc
ggtgcaactggtacacgcttagtaacgacacttgtgaatgtattgtcacaagaggataaa
caaagtggtatcgctacggcttgtattggcggcggcttaggtatagcactagaaattgaa
aaggggcataaataa

DBGET integrated database retrieval system