KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_02155Help
Entry
Q426_02155        CDS       T03306                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00071  Fatty acid degradation
sequ00072  Synthesis and degradation of ketone bodies
sequ00280  Valine, leucine and isoleucine degradation
sequ00310  Lysine degradation
sequ00362  Benzoate degradation
sequ00380  Tryptophan metabolism
sequ00620  Pyruvate metabolism
sequ00630  Glyoxylate and dicarboxylate metabolism
sequ00640  Propanoate metabolism
sequ00650  Butanoate metabolism
sequ00900  Terpenoid backbone biosynthesis
sequ01100  Metabolic pathways
sequ01110  Biosynthesis of secondary metabolites
sequ01120  Microbial metabolism in diverse environments
sequ01130  Biosynthesis of antibiotics
sequ01200  Carbon metabolism
sequ01212  Fatty acid metabolism
sequ02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sequ00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Q426_02155
   00630 Glyoxylate and dicarboxylate metabolism
    Q426_02155
   00640 Propanoate metabolism
    Q426_02155
   00650 Butanoate metabolism
    Q426_02155
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Q426_02155
   00072 Synthesis and degradation of ketone bodies
    Q426_02155
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Q426_02155
   00310 Lysine degradation
    Q426_02155
   00380 Tryptophan metabolism
    Q426_02155
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Q426_02155
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Q426_02155
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Q426_02155
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sequ04147]
    Q426_02155
Enzymes [BR:sequ01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Q426_02155
Exosome [BR:sequ04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q426_02155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIA67293
UniProt: A0A0E1DXP2
Position
431331..432446
Genome map
AA seq 371 aa AA seqDB search
MIDVYIQRGLRTPIGLAGKQFARVRPELLGAQLINALVKVDKLAIDEVICGNAVGTGGNI
GRLMTLYSDLGETVPAITVDMQCASAGAALTMGYAKIKAGLATSLLAGGIESSSLQPQRI
YAAADSRSGAYQVAQFSPDTSSQLAMIAGAERVAQAYQMTPSQLNQWTLTSHQRAHIARQ
KHWLADIILAMPGMSDQGIRPRLSEKVLSKVPPILDKAGLISAANTCLTHDAAAFLVLSS
QRSAYQILDLVEVAGNPKTSPQMVVEASQVLLARNGLAMTDMDAIEWNEAFAVIDLLFEH
YFVEALDRYNIFGSALAYGHPFGASAAIIILHLMQALALKQGRYGLAAIPAAGGQAFALL
LEYHKDYSHAI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtctacattcaaagagggcttagaacgcctattggtctagctggcaagcaa
tttgctagggtgcgtccagaactgcttggtgctcagctgattaatgccttagtcaaagta
gataagctggctattgatgaggtgatctgcggtaatgctgttgggacaggcggtaatatt
ggccggctgatgactctgtattctgacttgggagagaccgtacctgccataaccgttgac
atgcaatgtgcctcggctggtgcagctcttactatgggctatgctaaaatcaaggcaggt
cttgccactagcttgttagcaggagggatcgaaagcagctctttgcagcctcagcgtatc
tatgctgctgctgatagccgatcaggtgcttatcaggtagctcagttttcaccagatacc
agtagccagctggctatgatagcaggagcagagcgggtggctcaggcctaccaaatgacc
ccctcgcagctcaaccaatggacccttactagccaccagcgagcacacatagctaggcag
aagcattggttagctgatattatattagcaatgccaggtatgtctgatcagggcattcgc
cctcgcctgtcagaaaaggtcttgagcaaggtgccgccgatacttgataaggctggcctc
atcagtgctgctaatacctgcttgactcatgacgcagcagcatttttagtgctaagcagt
caaagatcagcctatcaaatccttgatcttgttgaggttgctggcaatcctaaaaccagt
cctcaaatggtggttgaggccagtcaggtcttattagctagaaacggcctagccatgacg
gatatggatgcgatcgagtggaatgaagcttttgcagtgattgatctgctttttgagcac
tattttgtggaggcccttgatcgctacaatatttttggaagcgctcttgcctacggtcat
ccctttggcgcgtcagcagccattatcattttgcatctaatgcaggctttggccttaaag
caaggaaggtatggtttagcagccattccagcagctggtggtcaagcctttgccctgtta
ttggaatatcataaggactactcacatgctatctag

DBGET integrated database retrieval system