KEGG   Streptococcus equi subsp. zooepidemicus CY: Q426_06705Help
Entry
Q426_06705        CDS       T03306                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sequ  Streptococcus equi subsp. zooepidemicus CY
Pathway
sequ00450  Selenocompound metabolism
sequ00970  Aminoacyl-tRNA biosynthesis
sequ01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sequ00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Q426_06705
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Q426_06705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sequ01007]
    Q426_06705
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sequ03016]
    Q426_06705
Enzymes [BR:sequ01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Q426_06705
Amino acid related enzymes [BR:sequ01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Q426_06705
Transfer RNA biogenesis [BR:sequ03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Q426_06705
 Prokaryotic type
   Other AARSs
    Q426_06705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AIA67959
UniProt: A0A0E1DYI1
Position
complement(1351918..1353921)
Genome map
AA seq 667 aa AA seqDB search
MTKKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRMMGYDVFYLTGLDEHGQKIQD
KAQEAGLSPQAYVDGMAEEVKALWKLLDISYDKFIRTTDDYHEEVVAAVFERLLAQDDIY
LGTYSGWYSVSDEEFFTESQLAEVYRDEAGKVIGGVAPSGHEVEWVSEESYFLRLSKYAD
RLVAFFKAQPDFIQPDGRMNEMLKNFIEPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWID
ALLNYATALGYGQKDHANFDKFWSGRVFHMVGKDILRFHSIYWPILLMMLDLPMPERLIA
HGWFVMKDGKMSKSKGNVIYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINY
ELANDLGNLLNRTVAMINKYFDGRVPAYVKNVTAFDADLEQVVADHISEYHKQMEAVDYP
RALEAVWTIISRTNKYIDETAPWVLAKAADSKEQLASVMAHLAASLRVVAHLIQPFMMTT
SAAMMEQLGLGAKYHLEELDLADLPTGVTVVAKGEPIFPRLDMEAEINYIKEQMKMSTAK
PQEADWDPEKVALKSEKDTITFEAFDAIELRVAEVKEVSRVEGSEKLLRFRLDAGDGEDR
QILSGIAAYYPNEQELVGKKVQIVANLKPRKMMKKYISQGMLLSAEHDGKLTVLTVDPAV
PNGAIIG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgactaagaaaaaaccattttatattacaactccgatttactacccgtcagggaagctt
catattggctctgcctatactactatcgcttgtgatgtgcttgctcgctataagcgtatg
atgggttatgacgttttttatttgactggtcttgatgagcatggtcaaaagattcaggat
aaggcacaagaagccggcttatcccctcaagcttatgttgatggcatggctgaggaagtc
aaggcactatggaagctccttgatatttcttatgataagtttatccgcaccactgacgac
tatcatgaggaggtggttgctgctgtatttgagaggttgctggcgcaggatgatatttat
ttagggacctattcaggctggtattctgtttcagatgaggaattttttacagaaagtcag
ttagctgaggtttatcgcgatgaagctggcaaggtcattggtggtgtggcaccatcaggg
catgaggtcgaatgggtctctgaagaatcttattttttacgcctgagcaagtatgcggat
agattggttgccttctttaaggctcagcctgattttattcagccggacggtcgcatgaat
gaaatgcttaaaaacttcattgagccaggtctggaggatctagcggtgagtcgaacaacc
tttacctggggagttcctgtaccatcagatcctaagcacgttgtttatgtctggatcgat
gctctcttaaactatgcaacagcactaggctacggtcagaaggatcatgctaacttcgat
aagttctggagtggtagggttttccatatggttggtaaggatattttgcgtttccacagc
atttattggccaattttgttgatgatgcttgatttaccaatgccagagcgtttgattgct
catggctggtttgtcatgaaggatggtaaaatgtctaaatcaaagggaaatgtgatttac
cctgaaatgctggttgagcgttttggtcttgatcctctgcgttattacctcatgcgttcc
ttgccggttggctctgatggcacctttaccccagaggattatgttggtcggattaattat
gagctggctaatgaccttggtaaccttttgaaccgtacagttgccatgattaataaatac
tttgacggcagggttcctgcttatgtcaaaaacgttacagcctttgatgcggatctggag
caggttgtggctgatcatatttccgaataccacaagcaaatggaggctgttgattaccca
cgtgccttagaggccgtatggacgattatttcacgcacgaacaaatacattgacgagaca
gctccttgggtgcttgccaaagcagctgatagtaaggagcagctagccagtgtgatggca
catttagctgcaagtctgcgcgtggtggctcatttgattcagccatttatgatgacaacc
tcagctgctatgatggagcagctaggtctcggtgccaaatatcatctggaagagcttgat
ttagcagatcttccgacaggtgtgacggttgttgccaaaggagagccgatctttcctcgt
cttgatatggaagcagagattaactatatcaaagagcaaatgaaaatgagtacagctaag
ccgcaagaagcagactgggatcctgaaaaggtagcccttaagtctgaaaaggacacgatt
acttttgaggccttcgatgctatagagcttcgtgtagcagaggtaaaagaggtatcacga
gttgaaggctctgaaaaactgctgcgctttagattagatgctggtgatggcgaagaccgt
caaatcctgtcaggtattgcagcctattacccaaatgaacaagagctcgtcggcaagaag
gtgcaaattgttgccaacctcaagccgcgaaaaatgatgaaaaaatatatcagtcagggc
atgcttttgtcagcagagcatgatggcaagctgacagtgctgacggttgatccggcagtg
ccaaatggtgcgattattggctga

DBGET integrated database retrieval system