KEGG   Staphylococcus epidermidis RP62A: SERP0036Help
Entry
SERP0036          CDS       T00229                                 

Definition
(GenBank) trans-sulfuration enzyme family protein
  KO
K01760  cystathionine beta-lyase [EC:4.4.1.8]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00270  Cysteine and methionine metabolism
ser00450  Selenocompound metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SERP0036
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SERP0036
Enzymes [BR:ser01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.8  cystathionine beta-lyase
     SERP0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 SelA Met_gamma_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: AAW53412
UniProt: Q5HS03
Position
complement(32490..33665)
Genome map
AA seq 391 aa AA seqDB search
MSLSKETEVIFDVRRGKDYDSANPPLYDSSTFHQKVLGGETQYDYARSGNPNRTLLEEKL
ARLEGGKYAFAYASGIAAISAVLLTLNAGDHVILPDDVYGGTFRLTEQILNRFNIEFTTV
NATHIDHITEAIQSNTKLIYVETPSNPLFKITDIHAVATLAKEHKILLAVDNTFMTPLGQ
SPLALGADIVIHSATKFLGGHSDLIAGAAITNNREVANALYLLQNGTGTALSAYDSWALA
KHLKTLPVRFKQSVHNAERLVQFLSQREEISEVYYPGNNPTHLKQASTGGAVIGFRLKDE
SKAQKFVDSLTLPLVSVSLGGVETILSHPATMSHAAVPEDVRRERGITFGLFRLSVGLEN
PEELIADFNYALKEAFNESFTEPIKEQRFSS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttatctaaagaaacagaagtaatattcgatgtgcgtagaggtaaagactacgac
tcagctaacccgccactttacgattcatctacattccatcaaaaagtgttaggcggtgag
actcaatatgattatgcacgaagtggtaaccctaaccgaactttacttgaagagaaactt
gcacgtttagaaggtggtaaatatgcatttgcttatgcttcaggcattgctgcaatttca
gccgttttactcacattaaacgcaggggatcatgttattttacctgatgatgtttacggg
ggcacatttagattaactgaacaaatactcaatcgattcaatattgaatttactacagtt
aacgctacacatatagatcatatcactgaagctattcaatcaaacacaaaactcatctat
gtagagacgccttcaaatccacttttcaaaattacagatattcatgctgtagcaacgcta
gcaaaggaacataagatactattagctgttgataatacgtttatgacacctttgggtcaa
tcacctttagcactaggcgctgacatagttattcatagtgcaactaaatttctaggtgga
catagcgatttaattgcaggtgcagcaattactaataatagagaggttgcaaatgcattg
tacttattacagaacggcacgggcacagccctttctgcatatgatagttgggcacttgca
aaacatcttaaaacattaccagttcgttttaaacaatctgttcataatgctgaacgtctt
gttcaatttttgagtcaaagagaggagatttctgaggtgtattacccaggaaataatcct
acacatctcaagcaagcttcaactggaggtgcagtgataggtttccgacttaaagatgaa
tctaaagcacaaaagttcgtcgattctcttactttaccacttgtatcagtgagtctcggt
ggtgtagaaactatcctatcacatcccgcaacaatgtctcatgcagcagtgccagaagat
gtgagacgtgaacgtggcatcactttcgggttattccgtttaagtgtaggtcttgagaat
ccagaagaactcatcgcagattttaactacgctttaaaggaggctttcaatgagtcattt
actgaaccaattaaagagcaacgttttagtagctga

DBGET integrated database retrieval system