KEGG   Staphylococcus epidermidis RP62A: SERP0059Help
Entry
SERP0059          CDS       T00229                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  alkyl hydroperoxide reductase subunit F [EC:1.6.4.-]
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.4  With a disulfide as acceptor
    1.6.4.-  
     SERP0059 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 Thi4 AlaDh_PNT_C FAD_binding_3 NAD_binding_8 DUF5459 DAO K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AAW53450
UniProt: Q5HRY2
Position
complement(46330..47853)
Genome map
AA seq 507 aa AA seqDB search
MLNADLKQQLQQLLELMEGDVEFVASLGSDDKSNELKELLNEMAEMSAHITITEKSLKRT
PSFSVNRPGEETGITFAGIPLGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGPFHFE
TFVSLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFREESENIMAVPAVFLDGQEFGNG
RMTVQDILTKLGSTQDASEFNDKDPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
QVNDTAGIENFITVKETTGSEFSSNLAEHIAQYDIDTMTGIRATNIEKTDSAIRVTLEND
AVLESKTVIISTGASWRKLNIPGEDRLINKGVAFCPHCDGPLFENKDVAVIGGGNSGVEA
AIDLAGIVKHVTLFEYASELKADSVLQERLRSLPNVDIKTSAKTTEVIGDDYVTGISYED
MTTGESQVVNLDGIFVQIGLVPNTSWLQNAVELNERGEVMINRDNATNVPGIFAAGDVTD
QKNKQIIISMGAGANAALNAFDYIIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatgctgatttaaagcaacaattacaacaattacttgagcttatggaaggcgac
gttgaattcgttgccagcctaggctctgatgataaatcaaacgaactcaaagaattatta
aatgagatggctgagatgtcagcacacataacaataactgaaaaatctttaaaacgtaca
ccaagtttttcagttaatcgccctggtgaagaaacaggtattacctttgctggcatacct
ttaggccatgaattcaactctttagtattagctatactacaagtgagtggtcgcgcacct
aaagaaaagcaatccattattgatcaaattaaagggctcgaaggtccatttcatttcgaa
acctttgtaagtcttacttgtcaaaagtgtcctgacgtcgttcaagcattaaacctaatg
agtgttattaatcctaacattactcatactatgattgatggcgctgttttccgtgaagaa
tctgaaaacattatggcagttcctgccgtcttcttagatggtcaagaatttggtaatgga
cgcatgacagttcaagatattttaactaaattaggaagcacgcaagatgcctctgaattc
aacgataaagatccttatgacgtgttaatcgttggtggcggacctgcaagtggtagtgct
gcaatttatacagcacgtaaagggctacgtacaggtattgtcgctgatcgaattggtggt
caagttaatgatactgctggtatcgagaacttcatcactgttaaagaaacgacaggttca
gagttctcatcaaatcttgcagaacatattgcacaatatgatattgatacaatgactggt
attcgtgctacaaatatcgaaaaaacagattcagctattcgcgtaactttagaaaatgat
gctgttttagaaagtaaaactgtcatcatttccacaggtgcaagttggcgtaaactaaac
atcccaggcgaagaccgtctaatcaataaaggcgtggctttctgccctcactgtgacgga
cctttatttgaaaataaagatgttgctgtcatcggtggtggtaactctggtgtagaagca
gctattgatttagccggcatcgttaaacacgtaacattatttgaatacgcttctgaatta
aaagctgatagcgtattacaagaacgtttacgctcactacctaatgttgatattaaaacg
agtgctaaaacaacagaagtaattggtgacgattacgttacaggtattagctatgaagat
atgactaccggagagtcacaagtagttaatttagatggaatatttgtacagattggatta
gttcctaatacatcttggttgcaaaatgctgtcgaattaaatgaacgtggcgaggttatg
attaatcgcgataacgcaacaaacgttcctggtatctttgcagctggtgacgttaccgat
caaaaaaataagcaaattattatttctatgggtgctggtgctaatgccgcacttaatgca
ttcgattatataattagaaattaa

DBGET integrated database retrieval system