KEGG   Staphylococcus epidermidis RP62A: SERP0811Help
Entry
SERP0811          CDS       T00229                                 

Definition
(GenBank) GTP-binding protein, putative
  KO
K14540  ribosome biogenesis GTPase A
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Ribosome biogenesis [BR:ser03009]
 Prokaryotic Type
  GTPases
   SERP0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMR_HSR1 FeoB_N RsgA_GTPase AAA_18 Arf Dynamin_N ArgK GRAS AIG1 Septin SRPRB Roc Lipase3_N AAA_14 RNA_helicase AAA_25
Motif
Other DBs
NCBI-ProteinID: AAW54149
UniProt: Q5HPU7
Position
814088..814951
Genome map
AA seq 287 aa AA seqDB search
MAIQWYPGHMAKAKRQVSEQLKKVDVVFELVDARIPYSSRNPMIDDVIKQKPRVVILNKK
DMTNLKELEKWETYFKDEGFYPVAVDAKHGKNLKNVEVEAIKATQEKFDREKAKGLKPRA
IRAMIVGIPNVGKSTLINKLAKRSIAETGNKPGVTKQQQWIKVGKSLQLLDTPGILWPKF
EDEEVGKKLSLTGAIKDSIVHLDEVAIYGLNFMIKHDVSALKRHYNIDTHEDAEILDWFD
AIGRRRGLLQKGNEVDYESVIELIINDMRNAKIGTYCFDILKEMKSE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggcgatacaatggtatccaggtcatatggctaaagccaaaagacaagttagtgaacaa
ctgaaaaaggtagatgtagtttttgaactcgtcgatgcacgtattccatacagttcgaga
aaccctatgattgatgatgtcattaaacaaaaacctcgagtagtaattttaaataaaaaa
gatatgacgaatttaaaagaattagaaaaatgggaaacttattttaaagatgaaggtttc
tatccggtagctgtagatgcaaaacatggcaagaatcttaaaaatgttgaagttgaagct
ataaaagcaactcaagaaaaatttgatcgtgaaaaagctaaaggtttaaaacctagagcg
ataagagctatgattgtaggcattcctaatgtaggaaaatcaacacttatcaataagtta
gcaaaacgtagtatcgccgaaactggaaataaaccaggagtaacaaaacagcaacaatgg
attaaagttggaaagtctcttcaattactagatacaccaggtattttatggcctaaattc
gaagatgaagaagtcggtaaaaaattaagtttaactggtgcaattaaggatagtatcgtt
catttagatgaggtagctatttatggtttgaattttatgattaaacatgatgtttcagct
ttaaagagacattataatattgatacacatgaagacgctgagatactcgattggtttgat
gcaattggaagaagaaggggattgttacaaaaaggaaatgaagtagattatgaatctgtc
attgagttgatcatcaatgatatgagaaatgcaaaaattggaacttattgttttgatatt
ttaaaagaaatgaagagtgaatga

DBGET integrated database retrieval system