KEGG   Staphylococcus epidermidis RP62A: SERP0951Help
Entry
SERP0951          CDS       T00229                                 

Definition
(GenBank) peptide ABC transporter, ATP-binding protein, putative
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02024  Quorum sensing
Module
ser_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    SERP0951
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    SERP0951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 AAA_16 AAA_10 BCDHK_Adom3 DUF815 RsgA_GTPase AAA_23 AAA_29 AAA_21 AAA T2SSE AAA_19
Motif
Other DBs
NCBI-ProteinID: AAW54354
UniProt: Q5HPG1
Position
complement(967733..968509)
Genome map
AA seq 258 aa AA seqDB search
MKLLTIKNLNISDKEEQAIIKNVDLNIYHQSLNVIIGESGAGKSLTVKAILNHLPTQLHM
SFDEFKMQGQNTSGIKQLLGKHIGYISQNYAQSFNEYTRLDKQLIAIYRYHFNVSKDNAL
KKIKKALTWVNLNDESIINKYSFQLSGGQLERVNIASVLMLDPELIIADEPVASLDVVNG
HQIMQLLQHIVKDHHNTVLLITHNMNHVLKYADYFNVMKNGMMIESGEIGKLFNHQHLHR
YTEQLLSYRSKLQKEDNI
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacttttaacaataaaaaatctaaacatcagtgataaagaagagcaagcaattatt
aaaaatgtcgacttaaatatatatcatcaatctctaaatgtcattataggtgaaagtggt
gctggaaaaagtttgactgttaaagcaatattaaatcatttacctactcagttacatatg
agtttcgatgaatttaaaatgcaaggtcaaaatacttctggtatcaagcaacttttaggt
aaacatatcggctatatctctcaaaattatgctcaaagttttaatgaatatactcggtta
gataaacaacttatagctatttatcgttatcattttaatgtttccaaggataatgcattg
aaaaagataaaaaaagctttaacttgggttaacttaaatgatgaatcaatcattaataaa
tatagtttccaactttcagggggacaattagagcgagttaatattgctagcgttttaatg
ttagatccagaattaattattgcagatgaacctgttgcatctttagatgtagtgaacggt
catcaaataatgcaactccttcaacatattgtcaaagatcatcataatactgtattactc
atcactcataacatgaatcatgtcctcaaatatgctgattattttaatgtaatgaaaaat
ggcatgatgattgaatctggagaaataggcaaattatttaatcaccaacatcttcatcgg
tatacagaacaattattaagctatagaagcaagctgcaaaaggaggataatatctaa

DBGET integrated database retrieval system