KEGG   Staphylococcus epidermidis RP62A: SERP1384Help
Entry
SERP1384          CDS       T00229                                 

Definition
(GenBank) DNA-binding response regulator, LuxR family
  KO
K02479  two-component system, NarL family, response regulator
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Two-component system [BR:ser02022]
 NarL family
  Unclassified
   SERP1384
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 HTH_23 HTH_24 Phage_terminase RPW8 HTH_28 DUF2089 HTH_40 HTH_38 HTH_Tnp_ISL3 Sigma70_ECF Gp49
Motif
Other DBs
NCBI-ProteinID: AAW54777
UniProt: Q5HN88
Position
complement(1441233..1441856)
Genome map
AA seq 207 aa AA seqDB search
MHKVILVDDHYIVRQGLEFLLSTVDDLSVLKGFKDGATFLSYLKNNERPDIVLLDLVMPE
MNGIEITEILKQQYPEIKVLVLTSYVDDEHVISAIDKGADGYEMKDVEPQKLIETIHKVL
QGERIIHPQAKSVIKAVSKKPHYTNKLSKREKEVLKEMVKGKTNKEIARALFVSEKTVKT
HVSHIFSKLEVSDRTQAAIYAMENKLI
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagtcattctcgtcgatgatcactatattgtaaggcaaggtttagagttttta
ttatcaactgtagatgatttatcagttttaaagggttttaaagatggcgcaacattttta
tcttatttaaaaaacaatgaaagaccggacatcgtgcttttagacttagtaatgccagag
atgaatggtatagaaattactgaaatactcaaacaacaatatcctgaaatcaaagtatta
gtacttacgagctatgtagatgatgaacatgttatttcagctattgataaaggagctgat
gggtatgaaatgaaagatgttgaacctcaaaagttaattgagacaattcataaagttttg
caaggtgaacgtatcatacatcctcaagctaaaagcgtgattaaggccgtatcaaaaaaa
ccgcattatacgaataagttatctaaacgtgaaaaagaagtgcttaaggaaatggttaaa
ggtaaaacaaataaagaaattgcaagagcattgtttgtatcagaaaagacagtaaaaaca
catgtgagtcatatttttagcaaactagaagtctccgatagaactcaagccgctatttat
gcaatggaaaataaattgatttaa

DBGET integrated database retrieval system