KEGG   Staphylococcus epidermidis RP62A: SERP2031Help
Entry
SERP2031          CDS       T00229                                 

Definition
(GenBank) amino acid ABC transporter, ATP-binding protein
  KO
K05847  osmoprotectant transport system ATP-binding protein
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser02010  ABC transporters
Module
ser_M00209  Osmoprotectant transport system
Brite
KEGG Orthology (KO) [BR:ser00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SERP2031
Transporters [BR:ser02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Osmoprotectant transporter [MD:M00209]
    SERP2031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran CBS AAA_21 AAA_15 AAA_16 AAA_30 AAA_22 Zeta_toxin AAA_29 NTPase_1 AAA_23 T2SSE AAA_18 AAA RsgA_GTPase FtsK_SpoIIIE AAA_28
Motif
Other DBs
NCBI-ProteinID: AAW52857
UniProt: Q5HLF6
Position
complement(2050663..2051919)
Genome map
AA seq 418 aa AA seqDB search
MLSIKNLTKIYSGNKKAVDNISLDIQSGEFIAFIGTSGSGKTTALRMINRMIEATDGQIM
MNGKDVRNMNPVELRRSIGYVIQQIGLMPHMTIRENIVLVPKLLKWSKEKKDEKAKELIK
LVDLPEEYLDRYPAELSGGQQQRIGVVRALAAEQDIILMDEPFGALDPITRDTLQDLVKE
LQQKLGKTFIFVTHDMDEAIKLADKICIMSKGKVVQYDTPDNILRYPANDFVRDFIGQNR
LIQDRPNMKSVESAMIKPVTVKADDSLNDAVNIMRTRRVDTIFVVNNQNKLLGFLDIEDI
NQGLRARKELIDTMQRDVYKVHINSKLQDSVRTILKRNVRNVPVVDNDEHLIGLITRANL
VDIVYDSIWGEEDSDSYEIPNESLDENNHDLPQNQTDTRTNINEDVNDYHDAQHRGED
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtattaaaaacttaaccaagatttattcagggaataaaaaagcggtagataat
atttctttggatattcaatctggtgaatttatcgcttttattgggacgagtggtagtggt
aaaacaactgcactacgcatgattaatcgtatgattgaggcgacagatggacagattatg
atgaatggaaaagatgtccgtaatatgaatcctgttgaattgcggagaagtatcggttat
gtcattcaacaaattggtttgatgccacatatgactattcgagaaaatattgttttagta
cctaaacttttaaaatggtctaaagagaagaaagatgaaaaagctaaagaacttattaaa
ctggtagatttacctgaagaatatttggatcgttatccagctgaattgtcaggagggcaa
caacaacgaattggtgttgtgcgcgctttagcagctgaacaagatattatattaatggat
gaacctttcggtgcattagatcctattacacgcgatacattacaagatttagtaaaggaa
ttacaacaaaaattaggaaaaacatttatttttgtcactcatgatatggatgaggctatt
aaattagcagacaaaatatgtattatgtctaagggaaaagtcgttcaatacgatacacct
gacaatattttacgatatcctgcaaatgactttgttagagattttattgggcaaaatcgc
ttgattcaggatcgtcctaatatgaaatctgtggaaagtgctatgatcaaacccgtcact
gttaaagcagatgattcattgaatgatgcagtaaatattatgagaacacgtcgagtagac
actatttttgtagtcaataatcaaaataaattattaggatttttagatattgaagatatc
aatcaaggattacgtgcgcgtaaagaattaattgataccatgcaaagggatgtctacaaa
gtacatatcaattcaaagttacaagactcagtgcgtactattctaaaacgtaatgttaga
aatgtacctgtggtcgataatgatgaacatctcattggtttaattacacgtgcaaactta
gtcgatattgtgtatgactcaatttggggcgaagaagattctgatagttatgagatccca
aatgaaagcttagatgagaataatcacgatttaccacaaaatcaaactgatacacgaaca
aatataaatgaagatgtgaatgattatcatgatgctcaacatagaggtgaggattaa

DBGET integrated database retrieval system