KEGG   Staphylococcus epidermidis RP62A: SERP2324Help
Entry
SERP2324          CDS       T00229                                 

Definition
(GenBank) acetoin dehydrogenase, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00020  Citrate cycle (TCA cycle)
ser00620  Pyruvate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
Module
ser_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP2324
   00020 Citrate cycle (TCA cycle)
    SERP2324
   00620 Pyruvate metabolism
    SERP2324
Enzymes [BR:ser01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SERP2324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 AATase DUF5321
Motif
Other DBs
NCBI-ProteinID: AAW53242
UniProt: Q5HKM0
Position
complement(2360269..2361546)
Genome map
AA seq 425 aa AA seqDB search
MSENIIMPKLGMTMKEGTVEEWFKSEGDTVKQGESIVTISSEKLTNDVEAPASGTLLEIK
VQAGEDAEVKAVLGIIGEEGEAIDKDEDDLASEKVKEDNEHEKETQEVKDTSQQSSDNKD
NSPKSAARERIFISPLARNMAEDKGLDINKIKGTGGNHRITKLDIQRVEANGYDYASDTT
SNEDTSHVPTQTVDTSAIGEGLNPMRQRIAQNMRQSLNSTAQLTLHRKVDADRLLDFKDR
LATELKQADQDVKLTVTTLLAKAVVLALKEYGAMNARYEQGELTEYEDVHLGIATSLDEG
LMVPVINHADTKSIGTLAHEIKSSAEAVREGNTGAVQLEGATFTITNMGASGIEYFTPIL
NLGETGILGVGALTKEVVLEADNIKQVSKIPLSLTFDHQILDGAGAADFLKVLAKYIENP
YLLML
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaaatattattatgccaaagcttggaatgacaatgaaagagggaactgttgaa
gagtggtttaaatcagagggtgacaccgtaaaacaaggagagagtattgttacaataagc
tctgaaaaattaaccaacgatgttgaagcgccggcgagtgggacattgttagaaattaaa
gtgcaagccggagaagatgcagaggttaaagcggtattaggtataattggagaagaaggg
gaagctattgataaagatgaagatgatttagcatcagaaaaagtaaaagaagacaacgag
catgagaaggaaacgcaagaagttaaagatacatcacaacagtcttccgataataaagat
aattcgcctaaaagcgcagcacgagaaagaatctttatctcacccctcgcacgtaatatg
gctgaggataaaggattagacattaacaagataaaaggcacaggcggtaatcatcgtatt
acaaaactagatattcaacgtgttgaagcaaatgggtacgactatgctagtgatacgaca
tctaatgaagatacaagtcatgttccaacacagactgtggatacaagtgcgattggtgaa
ggattgaatcctatgcgtcaacgtattgctcaaaacatgagacaaagtcttaatagtact
gctcaattaacattacatcgtaaggttgatgcggatcgcttgctagatttcaaagacaga
ttagctacggaacttaaacaagcagatcaagatgttaaattaactgttactacattatta
gctaaagcagtagtgcttgcacttaaagaatatggggcaatgaatgctcgctatgaacaa
ggcgagttaactgagtatgaagatgttcatttaggaatcgcaacgtctctagatgaaggc
cttatggtgccagtgattaatcatgcagatacaaaaagtatcggcactttagcccatgaa
attaaatcatcggctgaggctgttcgggaaggaaacacaggagcagtacaattagaggga
gcaacatttacaattactaatatgggtgctagtggtatagaatactttacaccaatttta
aatttaggtgaaacaggtattctaggcgttggtgctttaactaaagaagtcgtgctagaa
gcggataacattaaacaagtttcaaaaattcctttaagcttgacatttgatcatcaaatt
ttagatggtgcaggtgcggccgattttcttaaagtactagctaaatatatcgaaaaccct
tatttattaatgttatag

DBGET integrated database retrieval system