KEGG   Staphylococcus epidermidis RP62A: SERP2327Help
Entry
SERP2327          CDS       T00229                                 

Definition
(GenBank) acetoin dehydrogenase, E3 component, dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00020  Citrate cycle (TCA cycle)
ser00260  Glycine, serine and threonine metabolism
ser00280  Valine, leucine and isoleucine degradation
ser00620  Pyruvate metabolism
ser00630  Glyoxylate and dicarboxylate metabolism
ser00640  Propanoate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
ser01200  Carbon metabolism
Module
ser_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ser_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ser_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP2327
   00020 Citrate cycle (TCA cycle)
    SERP2327
   00620 Pyruvate metabolism
    SERP2327
   00630 Glyoxylate and dicarboxylate metabolism
    SERP2327
   00640 Propanoate metabolism
    SERP2327
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SERP2327
   00280 Valine, leucine and isoleucine degradation
    SERP2327
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SERP2327
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SERP2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox GIDA HI0933_like K_oxygenase NAD_binding_8 FAD_binding_2 FAD_oxidored AlaDh_PNT_C 3HCDH_N Lycopene_cycl XdhC_C TrkA_N NAD_binding_7 Thi4 RcsD_ABL DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAW53245
UniProt: Q5HKL7
Position
complement(2363666..2365018)
Genome map
AA seq 450 aa AA seqDB search
MSKSYDLIVIGAGPGGYVAAIRGAQLGKNVAVIEKNNAGGTCLNVGCIPSKTLLEHGEKA
HSIRVANDWGITTKDLKIDFTQFVQRKKKVVQTLTGGVKQLLKKNKVTYIEGEARISKNL
KVDVNNETYQAKDIILATGSQPFIPPIDGLDQVNYETTDTFFDLEKLPKQLAVIGGGVIA
TELASSMADLGVRVTIIEVADDILLTEINETREMLKAHLDNQGIKILTKAKIKQVKESKI
ILDGQDDVSFDTLLVATGRQPNTQVAKDLNLEMDGKFFKVNEHYETSQKHVYAIGDLIKG
YQLAHAASAHGIHVVETIMNKQPSLVRQEDITRCIYTRLEAASVGLSEEQAKEAGYDVKV
TQSAFQGNAKALIKGENEGFIKLVVDKKYGEVLGAFIVGPHATDIIGELLSVKASEGTIH
ELSQIIQPHPALLEAIGESADAFFDSAIHM
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatcatatgacttaatcgtaataggagctggacctggtggctatgtagctgca
atacgtggtgcgcaacttggtaaaaatgttgcagtcattgaaaaaaataatgctggaggc
acgtgcttaaatgtaggttgcatcccctctaaaacgttgttagaacacggcgagaaagca
cacagcatacgagttgcaaacgattggggaatcacaacgaaagacttaaaaattgatttt
actcaatttgtccaacgaaaaaagaaagttgtacaaacacttacgggtggcgtgaagcag
ttgttaaagaaaaataaagttacttatattgaaggggaagcacgaatttctaaaaactta
aaagtggacgttaacaatgaaacgtatcaagcgaaagatataattttagcaactggcagt
cagccgttcattccaccaattgatgggttagatcaagtcaattatgaaacaaccgataca
tttttcgatttagagaagctaccaaaacagttagcggttatcggtgggggtgtgattgca
acagaactcgcatcctcaatggctgatcttggggttagagttacgataatagaagttgca
gatgacattttattaactgaaatcaacgaaactagagaaatgttaaaagcacatttagat
aatcaaggtattaagatactgacgaaagcaaagataaaacaagtaaaggaatcgaaaata
atattagatgggcaagatgatgttagctttgatacccttcttgttgcaacaggtagacaa
ccgaatacgcaagttgcaaaagatttaaatttggaaatggatggtaaattctttaaagtc
aatgaacattatgaaacgagtcaaaaacatgtctatgctataggagatttaattaaagga
tatcaacttgcacatgcagcaagtgcgcatggcattcatgttgtcgaaacaataatgaac
aaacagccgtcacttgtgcgtcaagaagatattacgcgttgtatatacacaagacttgaa
gcagcatcagttgggttatcagaagagcaagctaaagaggctggttatgatgtgaaagtg
actcaatcagcatttcaagggaatgcaaaggcgttaatcaaaggagaaaatgaaggattt
attaaacttgtcgttgataaaaagtatggagaggttcttggtgcttttattgtaggacca
catgctacagatataattggagaacttttaagtgtcaaagcatcagagggtacgattcat
gaactttctcaaattattcaaccacacccggctttattagaagcaataggtgagagtgca
gatgcattttttgattctgcaattcatatgtag

DBGET integrated database retrieval system