KEGG   Staphylococcus epidermidis RP62A (MRSE): SERP0317Help
Entry
SERP0317          CDS       T00229                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ser  Staphylococcus epidermidis RP62A (MRSE)
Brite
KEGG Orthology (KO) [BR:ser00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SERP0317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AAW53679
UniProt: Q5HR76
Position
321131..322141
Genome map
AA seq 336 aa AA seqDB search
MSYILIVTIAIVIFSLIFDFINGFHDTANAVATAVSTRALTPRRAILLAAVMNFIGALTF
TGVAGTITKDIVDPFKLQHGLVVVLAAIIAAIIWNLITWLYGIPSSSSHALIGSIAGAAI
ASQGSFAVLHYQGFTKIIIVLIISPIIAFCVGYMMYTIVKIVFKNSNLTRTNRNFRFFQI
FTAALQSFSHGTNDAQKSMGIITLALIVGNLQDGSNVEPQVWVKVACATAMGLGTAVGGW
KIIKTVGGNIMKIRPANGAAADISSALTIFVASSLHFPLSTTHVVSSSILGVGASNRAKG
VKWSTAQRMVVTWVITLPISAVLAAIIYFIIHLFLK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatattttaattgtcacgatagctatagttatattttcattaatatttgacttt
atcaatggtttccatgatacagctaatgctgtagctactgcggtttctactcgagcatta
acaccaagaagagctattttattagcagcagtcatgaactttattggggcattgaccttc
acaggtgttgctggaactattacaaaagatatcgttgatccattcaaattacaacatggt
ttagttgttgtgttagcagctattattgctgccattatttggaatttaatcacttggttg
tatggaataccaagttcatcttctcacgcactaatcggatctatagcgggtgcagccatt
gcatcgcaaggttcgtttgcagtattacactatcaaggttttacaaaaattattatcgta
ttaatcatttcaccaattatagctttttgtgtaggttatatgatgtatacgattgttaaa
atcgtttttaaaaattcaaatttaacacgtactaatcgtaattttaggtttttccaaatc
tttactgcagcattacaatcattctcacatggtacaaacgatgctcaaaaatctatgggt
attatcacattagctttaattgtaggtaatttacaagatggtagtaatgttgaacctcaa
gtatgggttaaagttgcgtgtgcaacagctatgggattaggtacagcagtaggtggttgg
aaaatcatcaaaactgttggcggaaatattatgaaaattagacctgctaacggtgcagcc
gctgatatttcttcagcattaacgattttcgtagcgtcatcattacatttcccattatct
actacacacgttgtgtcttcatctattctaggtgtaggtgcttcaaatcgtgcgaaaggt
gttaaatggagtactgctcaacgtatggttgtaacatgggtgattactttacctatctca
gctgttttagcagcaattatttattttattattcatctgttcttaaaataa

DBGET integrated database retrieval system