KEGG   Staphylococcus epidermidis RP62A (MRSE): SERP1954
Entry
SERP1954          CDS       T00229                                 

Name
(GenBank) sensor histidine kinase
Organism
ser  Staphylococcus epidermidis RP62A (MRSE)
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 SKA2 Abi_alpha
Other DBs
NCBI-ProteinID: AAW52836
UniProt: Q5HLN1
Position
1969057..1970412
AA seq 451 aa
MFKTLYSRIAIYAITVILFSALMSFLFTNIYYHFHLKASNDAKIMRTLKEAREYERTQKP
KPLDTYLKHLGQMNYQIMTVNEHGTKHFYGETFRKNTISQSAIKKVLNGEDYHGIKNKPY
AFFVTGFFDNETDNTVGIQFKTDDGALAVFMRPDIGETFSEFRIFLAVLITLLLIISISL
VIASTYSIIKPVTALKNATTRIMKGDFSTPIKQTRHDEIGTLQSRFNTMRQNLGQVDQMR
QHFVQNVSHEVKTPLTHLQRLLTQLELTQNEEEKQLCINEMFEITNQVSELTKELLLLSE
LDNASHLTFNDNVHLNTLIKDIIRHEQFRTDEKDLVMFTELEDLYFRGNERLLHQAFNNL
IINAMNYAPQNSMINITLTSTNHLIIFNIENDGSIAEEDAKHIFDRFYKLSDESSSNGLG
LAITQSIIHLHHGSITLTSDDKTQFIVKLFI
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtttaaaacattatattcgagaattgctatatatgcaattacagtcattttgtttagt
gcattaatgagttttctttttacgaatatttattatcactttcatttgaaagcttctaat
gatgcaaaaattatgcgcacactcaaagaagctcgtgaatatgaaagaacacaaaaacct
aaacctctagatacgtatttgaaacatttaggtcaaatgaattatcaaattatgactgtc
aacgaacatggaaccaaacatttttatggggaaacttttcgtaaaaatactataagtcag
tctgcaatcaaaaaagtgctcaacggtgaagattatcatggtattaaaaataaaccttat
gcattttttgtaacagggttcttcgataatgaaacggataatacagtaggtattcaattt
aaaacagatgatggggcattagcagtttttatgcgcccagatatcggggaaacttttagc
gaatttagaattttcttagctgtgttgataacacttttacttattatttcaatttcacta
gtcattgcatcaacatattctattattaaaccagtgaccgcattaaaaaatgcaacaact
cgaattatgaaaggtgatttcagtacgcctatcaaacaaacacgtcacgatgaaatcgga
acactgcaatcacgtttcaatacaatgcgtcaaaatttaggacaagtagatcaaatgaga
caacattttgtccaaaatgtatctcatgaagttaaaacaccgcttacacatttacaacga
ttgcttacacaacttgaattgacgcaaaatgaagaagagaaacaactatgtatcaatgaa
atgtttgaaatcactaatcaagtaagtgaactaactaaggaattgctacttttatctgaa
ttagataatgcttcccaccttacttttaacgataatgttcatttaaatactttaataaag
gatattattagacatgaacaatttcgaactgatgaaaaagatttagttatgtttactgaa
ttagaagatttgtatttccgaggaaatgaaagactattacatcaagctttcaataacctc
atcattaatgcaatgaattatgctcctcaaaatagcatgattaatatcactctaactagt
acaaatcacttgattatatttaatattgaaaatgatggatcgattgcagaagaagatgcg
aaacatatcttcgatcgtttttataaactgagtgacgaatctagtagtaatggtctaggt
ctagccattacccaatcaatcattcatcttcatcatggtagcattactctcacttcagat
gataaaacacaatttattgtaaaactatttatttag

DBGET integrated database retrieval system