KEGG   Staphylococcus epidermidis RP62A: SERP2056Help
Entry
SERP2056          CDS       T00229                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00040  Pentose and glucuronate interconversions
ser00052  Galactose metabolism
ser00500  Starch and sucrose metabolism
ser00520  Amino sugar and nucleotide sugar metabolism
ser01100  Metabolic pathways
ser01130  Biosynthesis of antibiotics
Module
ser_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SERP2056 (galU)
   00052 Galactose metabolism
    SERP2056 (galU)
   00500 Starch and sucrose metabolism
    SERP2056 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    SERP2056 (galU)
Enzymes [BR:ser01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SERP2056 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2 RFC1 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AAW52903
UniProt: Q5HLD1
Position
complement(2080818..2081684)
Genome map
AA seq 288 aa AA seqDB search
MKKIKKAIIPAAGLGTRFLPATKAMPKEMLPILDKPTIQYIVEEASKAGIEDIIIVTGKH
KRAIEDHFDNQKELEMVLENKGKADLLEKVQYSTDLANIFYVRQKEQKGLGHAIHTAKQF
IGNEPFAVLLGDDIVESDTPAIKQLMDVYEETGHSVIGVQEVPESDTHRYGVIDPSAKEG
SRYEVRQFVEKPKQGTAPSNLAIMGRYVLTPEIFDYLETQQEGAGNEIQLTDAIERMNSK
QQVYAYDFEGNRYDVGEKLGFVKTTIEYALKDPEMSQDLKAFIKQLDI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaagataaaaaaagcaataattcctgccgctggtttaggtactcgttttttacca
gcaactaaggcgatgccaaaagaaatgttaccaatattagataaaccaacaatccaatat
attgtagaagaagcttctaaagcagggattgaagatattattatagtgactggcaagcat
aaacgtgcaattgaagatcactttgataatcaaaaagaattagaaatggttcttgaaaat
aaaggaaaagcagacctgcttgaaaaagtacaatattcaacagatttagctaatattttt
tacgtacgacaaaaagaacaaaaagggctaggacatgcaattcatactgcaaaacagttt
atcggtaacgaaccatttgcagtgttattaggagatgacattgtagagtctgatactcca
gctattaaacaattaatggatgtttatgaagaaacaggccattcagtaataggggttcaa
gaagtgccagaatctgatacacatcgttatggtgtgattgatccttctgctaaagagggg
agtcgatatgaagtacgtcaatttgtagaaaagccgaaacaaggtactgccccgtctaat
ttagcaatcatgggtcgttatgtattaacaccagaaatttttgattatcttgaaacacaa
caagaaggtgctggaaatgaaattcaattaactgatgcgattgaacgaatgaatagcaaa
caacaagtgtatgcatatgattttgagggtaatcgttatgatgttggagaaaaattagga
tttgttaaaacaacgattgaatatgctttaaaagatccagaaatgagtcaagacttaaaa
gcattcattaagcaactagatatttaa

DBGET integrated database retrieval system