KEGG   Staphylococcus epidermidis RP62A: SERP2136Help
Entry
SERP2136          CDS       T00229                                 

Definition
(GenBank) secretory antigen precursor SsaA
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHAP
Motif
Other DBs
NCBI-ProteinID: AAW53036
UniProt: Q5HLV2
Position
complement(2161089..2161862)
Genome map
AA seq 257 aa AA seqDB search
MKKIATATIATAGIATFAFAHHDAQAAEQNNDGYNPNDPYSYSYTYTIDAEGNYHYTWKG
NWSPDRVNTSYNYNNYNNYNYYGYNNYSNYNNYSNYNNYNNYQSNNTQSQRTTQPTGGLG
ASYSTSSSNVHVTTTSAPSSNGVSLSNARSASGNLYTSGQCTYYVFDRVGGKIGSTWGNA
NNWANAAARSGYTVNNSPAKGAILQTSQGAYGHVAYVEGVNSNGSIRVSEMNYGHGAGVV
TSRTISASQAASYNYIH
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcgctacagctacaattgcaactgcaggaatcgctactttcgcatttgca
caccatgacgcacaagcagcagaacaaaataatgatgggtacaatccaaacgacccttat
tcatatagctacacttacacaatcgatgctgaaggtaactaccactacacttggaaaggt
aactggagtccagatcgtgtaaatacttcatataactataataattataataactacaac
tactatggttacaataactatagcaactacaataactacagtaattacaacaattacaac
aactatcaatcaaacaacacgcaatcacaaagaacaactcaaccgactggtggtttaggc
gcaagctattcaacatcaagtagtaatgttcacgttacaacaacttctgcgccatcatca
aacggtgtatctttatcaaacgctcgctcagcatctggtaacttatacacttcaggtcaa
tgtacatattatgtatttgacagagtaggtggcaaaatcggttcaacgtggggtaacgca
aacaactgggcaaacgctgcagcacgttctggttacacagtaaacaattcgcctgctaaa
ggtgcaatcttacaaacgtcacaaggtgcatacggacacgtagcatacgttgaaggtgta
aacagcaatggttcaatcagagtttcagaaatgaactacggtcacggtgcaggtgttgtc
acttcacgtacaatctctgcgagccaagctgcttcatataactatattcactaa

DBGET integrated database retrieval system