KEGG   Staphylococcus epidermidis RP62A: SERP2142Help
Entry
SERP2142          CDS       T00229                                 

Definition
(GenBank) amino acid permease family protein
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
ser  Staphylococcus epidermidis RP62A
Brite
Transporters [BR:ser02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   SERP2142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease AA_permease_2 Vpu
Motif
Other DBs
NCBI-ProteinID: AAW53051
UniProt: Q5HL45
Position
complement(2169022..2170401)
Genome map
AA seq 459 aa AA seqDB search
MADKLQRELSNRHIQLIAIGGAIGTGLFLGAGQSIHLAGPSILLTYIIVGFVLFMFMRAM
GELLLSNLGFKSFGDIAHHHIGSMAGFMVGWTYWLTWIISGMAEVTAVAKYVSFWYPTIP
NWLTAAATILVLVALNLFSAKLFGELEFWLSIIKVLTILALIAVGVVMIVFGMKTSYGPA
TVTNIWKDGGFFPNGAQGFFMSFQMAIFSFIGIELIGITAGETKDPHKTIPQAINNVPFR
ILLFYIGSLAVIMSVVPWQQLNPADSPYVKMFGLVGIPFAAGIINFVVLTAAASSCNSGI
FANSRTMFGLAGRKQGPAFLHRTNKHGVPHYAILVTCGLLSISVVLNAIFKDATKVFVQI
TTFSTVLNIMIWTIIMIAYLGYLRHEPKQHKESNYKMWGGKYMAYSILGFFAFIFIILLI
NSATRYAVLSAPVWFVIMLLMYQKYKKESRKAKIKNEEE
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaactgcaaagagaattaagcaatagacatatacaattaattgctattggc
ggggctattggaacaggtttatttcttggtgctggccaatctattcatttagcaggccca
tctatcttactaacatacataatagtaggttttgttctctttatgttcatgagagctatg
ggagaattactgttatccaatttaggatttaaatcgtttggtgacattgctcatcatcat
attggttctatggcaggttttatggtggggtggacatattggttaacatggattatttca
ggaatggcagaggtgactgctgttgccaagtatgtttccttctggtatccaacaattcca
aactggttaacagctgcagcgactattttagttttagttgctttaaatctattcagtgct
aaattatttggagaattagaattttggctatctattattaaagttttgactattttagct
ttgatagccgttggtgttgttatgattgtatttggaatgaagacaagctatggccctgca
acggtaacgaatatatggaaagacggaggctttttccctaatggtgcacaaggtttcttc
atgtcattccaaatggcaattttctcatttattggtattgagttgattggaataactgca
ggggagactaaagatcctcacaaaacaattcctcaagcaattaataatgtaccgtttaga
atattattattttatataggatcgttggcagttatcatgtctgttgtaccatggcaacaa
ttgaatcctgctgacagtccatacgttaaaatgtttggattagttggaatcccttttgca
gcaggtattattaactttgttgtacttacagctgcagcctcttcttgtaatagtggtata
tttgctaatagccgtacgatgtttggattagctggaagaaagcaaggtccagcattctta
catagaaccaataagcacggcgtaccacattatgctattttagtgacatgtggcttatta
agtatttcagtcgtgttaaatgcaatttttaaagatgcgactaaagtgttcgtacaaatt
acaacattttcaactgttttaaatattatgatttggacaattattatgattgcgtatcta
ggttatttaagacatgaaccgaaacagcataaagaaagtaactataaaatgtggggcgga
aaatacatggcttacagtattttagggttctttgcatttatttttattatactattgatt
aatagtgcaacgcgttatgccgtactttctgcacccgtatggtttgttatcatgctattg
atgtatcaaaaatataaaaaagaatctcgcaaagctaaaattaaaaatgaggaagagtaa

DBGET integrated database retrieval system