KEGG   Staphylococcus epidermidis RP62A: SERP2151Help
Entry
SERP2151          CDS       T00229                                 

Gene name
panC
Definition
(GenBank) pantoate--beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00410  beta-Alanine metabolism
ser00770  Pantothenate and CoA biosynthesis
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
Module
ser_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:ser00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SERP2151 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SERP2151 (panC)
Enzymes [BR:ser01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     SERP2151 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: AAW53066
UniProt: Q5HL36
Position
complement(2177826..2178686)
Genome map
AA seq 286 aa AA seqDB search
MTKVITTINEMQSIVKQHQREGKTIGFVPTMGALHDGHLTMMKQSVSENDLTVISIFVNP
LQFGPNEDFDAYPRQLDDDVAAVKKLQVDYVFHPSVDEMYPEELGIHLKVGHLAQVLEGA
QRPGHFEGVVTVVNKLFNIVQPDYAYFGKKDAQQLAIVEKMVKDFNLPVHVIGIDIVREK
DGLAKSSRNIYLTSEERKEAKHLYQSLRLAKNLYEAGERDSNEIIGQIAAYLNKNISGHI
DDLGIYSYPNLIQQSKIHGRIFISLAVKFSKARLIDNIIIGDDYID
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttattacaacaatcaatgaaatgcaatctattgttaaacaacatcaacgt
gaaggtaaaacaataggattcgttccgactatgggagctttacatgatggtcatttaacc
atgatgaagcaatctgtaagcgaaaatgatctcacggttattagtatatttgtgaatccc
ttgcagtttggacctaatgaggattttgatgcttatccacgtcaactcgatgatgatgtg
gctgcagtaaaaaagttacaagtggattatgttttccatccgagtgtagatgaaatgtat
ccagaagaattaggtattcatctgaaagttggacacttggcacaagtattagagggagca
caaagacctggacacttcgaaggtgttgtgaccgtggtcaacaaactatttaatattgtg
caaccagattatgcctattttgggaaaaaggatgcacaacaattagctattgttgaaaag
atggttaaagactttaatcttcctgtacatgttatcggtattgatatcgtaagagaaaaa
gatggtttagccaaaagctctagaaatatttacttgacctctgaagaacgaaaagaggca
aaacatttatatcaaagtctacgcttagcaaagaatttgtatgaagcgggtgaacgagat
agcaatgagattataggtcaaatcgctgcgtatttaaacaaaaatattagtggacatatt
gatgatctgggtatttatagttatccaaatcttatacaacaatcaaagattcatggacga
atattcatatcattggcagttaaattttctaaagcaagattgatagataatataattatt
ggagatgactatattgattag

DBGET integrated database retrieval system