KEGG   Staphylococcus epidermidis RP62A: SERP2156Help
Entry
SERP2156          CDS       T00229                                 

Gene name
ldh
Definition
(GenBank) L-lactate dehydrogenase
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00010  Glycolysis / Gluconeogenesis
ser00270  Cysteine and methionine metabolism
ser00620  Pyruvate metabolism
ser00640  Propanoate metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
ser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SERP2156 (ldh)
   00620 Pyruvate metabolism
    SERP2156 (ldh)
   00640 Propanoate metabolism
    SERP2156 (ldh)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SERP2156 (ldh)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     SERP2156 (ldh)
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   SERP2156 (ldh)
  Exosomal proteins of breast milk
   SERP2156 (ldh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C NAD_binding_7 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: AAW53078
UniProt: Q5HL31
Position
complement(2183384..2184334)
Genome map
AA seq 316 aa AA seqDB search
MKKFGKKVVLVGDGSVGSSYAFAMVTQGIADEFVIIDIAKDKVEADVKDLNHGALYSSSP
VTVKAGEYEDCKDADLVVITAGAPQKPGETRLQLVEKNTKIMKSIVTSVMDSGFDGFFLI
AANPVDILTRYVKEVTGLPAERVIGSGTVLDSARFRYLISKELGVTSSSVHASIIGEHGD
SELAVWSQANVGGISVYDTLKEETGSDAKANEIYINTRDAAYDIIQAKGSTYYGIALALL
RISKALLNNENSILTVSSQLNGQYGFNDVYLGLPTLINQNGAVKIYETPLNDNELQLLEK
SVKTLEDTYDSIKHLV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttgggaaaaaagttgttttagtaggagacggttccgtaggttcaagttat
gcatttgctatggtgactcaaggaattgcagatgaatttgtaattattgatattgcaaaa
gataaagtggaagcagacgttaaagatttaaaccatggtgcactttacagttcttcacca
gtgactgtaaaagctggagaatatgaagattgtaaagatgcagatttagttgttattaca
gcaggtgcacctcaaaaaccgggtgaaactcgtttacaacttgttgagaaaaatactaaa
atcatgaaaagtatcgtaactagtgtcatggatagtggctttgatggtttcttcctaatt
gctgcaaacccagttgatatcttaacacgttatgttaaagaagttacaggtttaccagct
gaacgtgttattggttctggtacagtgcttgatagtgcaagattcagatatttaataagt
aaagaattaggtgttacatcaagtagtgttcacgctagcattataggtgaacatggtgac
tctgaacttgcagtttggtctcaagcaaacgttggaggtatttcagtgtatgatacattg
aaagaagaaactggtagcgatgctaaagcgaatgaaatttatattaatacaagagatgct
gcttacgatatcattcaagctaaaggatctacgtattatggtatagctctagcactatta
cgtatttctaaagctttactaaataatgaaaatagtattttgacagtttctagtcaactt
aatggtcaatatggatttaacgatgtttatcttggcttaccaacacttatcaatcaaaat
ggtgcagttaaaatttatgaaacaccattaaatgataacgaactacaattactagaaaaa
tcagtgaaaactttagaagacacttatgattctataaaacatttagtttaa

DBGET integrated database retrieval system