KEGG   Staphylococcus epidermidis RP62A: SERP2158Help
Entry
SERP2158          CDS       T00229                                 

Definition
(GenBank) amino acid permease family protein
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AAW53080
UniProt: Q5HL29
Position
2186581..2188032
Genome map
AA seq 483 aa AA seqDB search
MGSFFNRMTRKENPTIYQNKDGHLKRTLRVRDFLALGVGTIVSTSIFTLPGVVAAEHAGP
AVALSFLLAAIVAGLVAFTYAEMASTMPFAGSAYSWINVLFGELFGWVAGWALLAEYFIA
VAFVASGFSANLRGLIAPLGISLPKSLSNPFGSNGGVIDIIAAVVIILTALLLSRGMNEA
ARMENVLVILKVLAIILFVIVGLTAINFSNYIPFIPEHKVTETGDFGGWQGIYAGVSMIF
LAYIGFDSIAANSAEAINPQKTMPRGILGSLIVAIVLFVAVALVLVGMFHYSQYADNAEP
VGWALRESGHGIIAAIVQAISVIGMFTALIGMMLAGSRLLYSFGRDGLLPSWLSQLNHKH
LPNRALVILTIIGVVIGSMFPFAFLAQLISAGTLVAFMFVSLAMYRLRKREGKDLPKPEF
KLPLYPILPAITFILVLLVFWGLSFEAKLYTLIWFIVGIIIYLIYGIRHSKKNDEEAYQV
PRE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtttttttaatcggatgactcgaaaagagaatcctactatttatcaaaataaa
gatgggcatcttaagcgcacgttacgtgtacgtgactttcttgcactaggtgttggtaca
attgtctctacatctatcttcactttaccaggtgttgtcgcggctgagcatgccggacct
gctgtggcattatcattcttattagctgccattgttgcaggtcttgtagcctttacttat
gcagaaatggcatctacaatgccttttgctggatcagcttattcatggattaatgtactt
tttggtgaattattcggatgggttgccggttgggcgcttttagcagaatactttattgct
gttgctttcgttgcttcaggcttttctgctaacttaagaggtcttattgcaccattaggc
atttctttacctaaatcattatctaatccatttggaagtaacggtggtgtcattgatatc
attgctgctgtagtgattattttaactgcattactattatcacgcggaatgaacgaagcc
gctcgtatggaaaatgtattggttatattaaaggtgttagccatcattttatttgtgatt
gttgggctaactgcgattaatttcagtaactatataccatttattccagaacataaggtt
actgaaactggcgactttggaggttggcaaggtatttatgctggagtttcaatgattttc
ttagcttatattggttttgactctattgctgctaattcagctgaagcgattaatccacag
aagacaatgcctagaggaattttagggtcactcatagtagcaattgtattgtttgtggcc
gtagcacttgttcttgttggcatgttccactactctcaatacgctgataatgcagagcca
gtaggttgggcattacgagaaagtggtcatggtattattgctgcaattgttcaagcaatt
tctgtcatcggtatgttcactgcattaatcggtatgatgcttgcaggttcacgtctatta
tattcatttggacgagatggtttactcccttcttggttaagtcaattgaatcacaaacat
ttacctaatcgagcacttgtcatacttacaatcattggcgtagttatcggatcaatgttc
ccgtttgctttcttagcacaattgatttccgcaggtacccttgttgcattcatgtttgtg
tcactagcaatgtatcgattaagaaaacgtgaagggaaagatttacctaagccagagttt
aaattacctttatatcctattttgcctgcaattacatttatattagtattgctagtattt
tggggattaagttttgaagctaagttgtatacactgatatggtttattgtaggtataatt
atttatttaatttatggaattagacattccaaaaagaatgatgaagaagcgtatcaagta
cctagagaataa

DBGET integrated database retrieval system