KEGG   Staphylococcus epidermidis RP62A: SERP2179Help
Entry
SERP2179          CDS       T00229                                 

Definition
(GenBank) choline/carnitine/betaine transporter
  KO
K03451  betaine/carnitine transporter, BCCT family
Organism
ser  Staphylococcus epidermidis RP62A
Brite
KEGG Orthology (KO) [BR:ser00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SERP2179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BCCT
Motif
Other DBs
NCBI-ProteinID: AAW52982
UniProt: Q5HL08
Position
complement(2211424..2213028)
Genome map
AA seq 534 aa AA seqDB search
MDWTTFIGVVIVLLFAVIPMMVFPKASEIIITDINSAISNSIGSVYLFMGLAIFCFVLYI
AFGKYGNVTLGKATDKPEFNNFTWAAMLFCAGIGSDILYWGVIEWAFYYQVPPNGAKSMS
DQALQYATQYGMFHWGPIAWAIYVLPALPIGYLVFVKKKPVYKISQACRPILKGHTDKLL
GKIVDILFIFGLLGGAATSLALGVPMISAGIERLTGLDGSNMILRSIILLTITVIFAISS
YTGLKKGIQKLSDVNVWLSFLLLAFVFIVGPTVFIMETTVTGFGNMIKDFFHMATWMEPF
GGIKGRKETNFPQDWTIFYWSWWLVYAPFIGLFIARISKGRTLKEVVLGTICYGTLGCVL
FFGIFGNYAVYLQITEQFNVISYLNNYGTEATIIEIMHQLPFSTITIILFLISAFLFLAT
TFDSGSYILAAASQKKVIGEPLRANRLFWAFALCLLPFSLMLVGGERALEVLKTASLLAS
VPLIVIFTLMMISFLIILGRDRIKLERRADKHKEIERRSLRIVQVKDKPEDDNL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggactggacgaccttcataggcgtagtcattgtgttactttttgctgttatacctatg
atggtttttccgaaagcaagtgaaataatcattaccgatatcaatagtgccatttctaat
tcaattggatcggtatatctctttatgggactggctatattttgttttgttttatacata
gcatttggtaagtatgggaatgtcacgttaggaaaagcgactgacaaacctgaatttaat
aatttcacatgggcagccatgttattctgtgccggtattggttcagatattttatattgg
ggtgttattgagtgggcattttattatcaagtacctcctaacggtgcaaaatcaatgtcc
gatcaagcacttcaatatgcaactcaatatggtatgtttcactggggacctatagcctgg
gcaatatatgtgctaccagctttgccaatcggttatttagttttcgttaagaagaaaccc
gtctataaaattagtcaagcttgtcgaccaattttaaaaggacatacggataaattatta
ggaaaaatcgtagatattttatttattttcggtttgctcggtggtgctgcaacatcactc
gctctaggcgtgccgatgatctcagctggtattgaacgattgactggtttagatggatct
aatatgattttacgttcaatcatcttactaactattacagttattttcgcaatcagttct
tacacaggtttgaaaaaaggtattcaaaaattaagtgatgttaacgtttggttatcattt
ttattattagcatttgtattcatcgtaggtccaactgtgtttattatggaaactacagtt
acagggttcggtaatatgataaaagatttcttccatatggcgacatggatggaaccattt
ggtggcataaaaggtcgtaaagaaacgaatttccctcaagattggacaatattctactgg
tcatggtggctcgtttatgcaccgtttattggattgtttatcgcgcgtatctcaaaagga
cgtacacttaaagaagttgtattaggaacaatatgctatggaacattaggttgtgtgtta
tttttcggtatttttggtaactatgctgtatatctacaaattactgagcaatttaatgta
ataagctatttaaacaattatggtacagaggcaacaatcatagaaataatgcatcaacta
ccattctcgacaattactattatcttattcttaatatcagctttcttattcttagcaaca
acattcgattctggttcatatattttagcagcagcgtcacagaaaaaagtgataggagaa
ccgttacgtgctaatcgtttgttctgggcgtttgcgttatgtttactaccgttctcttta
atgctagttggaggagaacgtgcattagaagtattgaaaacagcatcattacttgctagt
gtacctttaattgttatatttacgctaatgatgatttcgttcttaattatactcggacga
gatcgtatcaagttagaaagacgtgcagataagcataaagaaattgaaagacgttctcta
agaatagttcaggtcaaagacaaacctgaagacgataacttataa

DBGET integrated database retrieval system