KEGG   Staphylococcus epidermidis RP62A: SERP2183Help
Entry
SERP2183          CDS       T00229                                 

Gene name
nrdD
Definition
(GenBank) anaerobic ribonucleoside-triphosphate reductase
  KO
K21636  ribonucleoside-triphosphate reductase (formate) [EC:1.1.98.6]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00230  Purine metabolism
ser00240  Pyrimidine metabolism
ser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ser00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SERP2183 (nrdD)
   00240 Pyrimidine metabolism
    SERP2183 (nrdD)
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.98  With other, known, physiological acceptors
    1.1.98.6  ribonucleoside-triphosphate reductase (formate)
     SERP2183 (nrdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NRDD Gly_radical A2L_zn_ribbon HypA
Motif
Other DBs
NCBI-ProteinID: AAW52986
UniProt: Q5HL04
Position
complement(2215661..2217511)
Genome map
AA seq 616 aa AA seqDB search
MTTLETSLTRLITKDPTILNENANKDSNTFSTMRDLTAGTVSKSYALDHLLPKHVAHAHQ
SGDIHFHDLDYHPFQPLTNCCLIDAKDMLENGFEIGNANVTTPQSIQTASAQLVQIIANV
SSSQYGGCTVDRVDELLSKYAQMNAQHHREVANDFVQPDKIENYVDTQVTKDIGDAIESL
EYEINTLYTSNGQTPFVTLGFGLGTDQLSRKIQQAILHTRIKGLGKDRVTAIFPKLVFSI
KKGVNFSPEDPNYDIKQLALECSTKRMYPDILNYDKLVELLGDFKAPMGCRSFLPSWKND
EGQLENNGRCNLGVVTLNVPRIAIEADGDMQQFWDIFEKRMQLLHDALVYRIQRLQDAIP
DNAPILYKSGAFKNKLTSEDTVDSLFTKQRATISMGYIGLYEAATLFYGPNWEHNPEAKT
FTLDILREMKRYQVEWTKQYDIWFSIYSTPSESLTDRFCRLDKEKFGFIPDVTDKGYYQN
SFHYDVRKDVTPFEKLDFEKDYPYYASGGFIHYCEYPKLNHNLKALEAVWDYAYDKVGYL
GTNIPIDHCYRCGYDGDFETTANGYRCPHCGNTDPKTVDVVKRTCGYLGNPVQRPVIEGR
QKEICARVKHMKEPRS
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgactactctagaaacatcattaactcgattaatcacaaaagatccaactatattaaat
gaaaatgcaaataaagatagtaatacattctcaacaatgcgagatttaacagctggaacg
gtatcaaagtcttatgcactcgatcatttacttccaaagcatgttgctcatgcacatcaa
tcgggagatattcattttcacgacttagattaccatccatttcaaccattaaccaattgt
tgtctcatagatgcaaaagatatgttagagaatggctttgagataggcaatgctaatgtt
acaacacctcaatcaatacaaaccgcttcagcacaacttgtacaaatcattgcaaacgtt
tcaagcagtcaatatggaggttgtactgtcgatcgtgttgacgaattactaagtaaatat
gcacaaatgaatgcacaacatcacagggaagtagcgaatgatttcgttcaacctgacaaa
attgagaattatgtggatacacaagtaactaaggatattggtgatgcaattgaaagttta
gagtatgagattaacacactctatacttccaatggacaaacgccattcgttactttggga
tttggtttaggaacagatcaattaagtcgaaaaattcaacaagcaattttacatacccgt
attaaaggtctcggtaaagatagggttactgcaattttccctaaacttgtattttcgata
aaaaagggggttaactttagtccagaagatcctaactatgatattaaacaacttgcattg
gaatgttcaacaaagcgcatgtatcccgatattttaaattacgataaacttgttgaactg
cttggtgattttaaagcaccgatgggatgtcgttcatttttaccaagttggaagaatgat
gaaggtcaattggaaaataatggacgatgtaacttaggtgtagtgacgttgaacgtaccg
agaattgcaatcgaagcagatggtgacatgcagcagttttgggatatctttgaaaaacgc
atgcaattattacatgatgcacttgtgtatcgaattcaaagactacaagatgctattcca
gataacgcgcctattttatataaaagtggtgcatttaaaaataaactcacttcagaagat
actgtcgattcattatttacaaaacaacgcgcaacgatttcaatggggtatatcggttta
tacgaagcggcaacattattttatggaccgaattgggaacacaatcctgaagctaaaaca
ttcacactagacatattaagagaaatgaaacgttatcaagtagagtggacgaaacaatat
gatatttggttcagtatatacagtacacctagtgaatcactaacagatagattttgccga
ttggacaaagaaaaatttggatttattccagatgttactgataaaggatattaccaaaat
tcattccactatgatgtgcgtaaagatgtaacgccgtttgaaaaattagattttgaaaaa
gactatccttactatgcaagtggtggattcattcattattgtgaatatccaaagttaaat
cataatctgaaagctttagaagcagtatgggattatgcttatgataaggtaggttattta
ggtacgaatattcctattgatcactgttatcgttgtggctatgatggagattttgaaact
actgctaacggatatagatgcccacattgtggtaacactgatcctaaaacggttgacgtt
gtaaaaagaacatgtggttatttaggaaatccagttcaaagacctgttattgaaggtcga
caaaaagagatatgtgcaagagtgaaacacatgaaggaacctcgttcatga

DBGET integrated database retrieval system