KEGG   Staphylococcus epidermidis RP62A (MRSE): SERP2188Help
Entry
SERP2188          CDS       T00229                                 

Definition
(GenBank) siroheme synthase, putative
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
ser  Staphylococcus epidermidis RP62A (MRSE)
Pathway
ser00860  Porphyrin and chlorophyll metabolism
ser01100  Metabolic pathways
ser01110  Biosynthesis of secondary metabolites
ser01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ser00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SERP2188
Enzymes [BR:ser01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     SERP2188
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     SERP2188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Shikimate_DH Sirohm_synth_M Spermine_synth TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_C Pyr_redox THF_DHG_CYH_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AAW52999
UniProt: Q5HKZ9
Position
complement(2221197..2221808)
Genome map
AA seq 203 aa AA seqDB search
MNMPLMIDLSNKKVVIVGGGKVATRRTKTLLAYTKHIHVVSPTITDTLQKYLETKQITYE
KKHFEPQDVENADVVIAATNQSDVNNDVGAALSKNVLFNHAGQADLGNITFPNFLKRDKL
TISVSTDGASPKLGQRIIKDLKDTYNEDYSMYIQFLYESRQYIKSLKIEPSDKQALLKQI
LSDKYLDEKKQQDFIRWLKSQVK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcccttaatgattgatttaagtaacaagaaagtcgtcattgtaggtggaggt
aaagtggcaacacgtcgtactaaaactttattagcttatacaaaacatattcatgttgta
agtccaacaattaccgatacattacaaaaatatctagaaacaaagcaaatcacttatgaa
aagaaacacttcgaaccacaagatgttgagaatgctgatgtggtcatcgcggctactaat
caatctgatgttaacaacgatgtgggggcagctttgtctaagaacgtattatttaatcat
gcaggacaagcagacctaggtaatataacgttccctaatttcttaaaaagagataaatta
acaataagtgtatcaactgatggtgcaagtcctaaattaggtcaacgaattattaaagat
ttaaaagatacatacaacgaagactattcaatgtatattcagtttttatatgaaagtaga
caatatattaaatcacttaaaattgagccatctgataaacaagcgttactcaagcaaatt
ttgtcagacaaatatttagatgagaagaagcaacaagatttcatccgatggctaaaatca
caagtcaaatga

DBGET integrated database retrieval system