KEGG   Staphylococcus epidermidis RP62A: SERP2199Help
Entry
SERP2199          CDS       T00229                                 

Definition
(GenBank) hypothetical protein
Organism
ser  Staphylococcus epidermidis RP62A
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAW53024
UniProt: Q5HKY8
Position
complement(2232343..2233452)
Genome map
AA seq 369 aa AA seqDB search
MTNQKTVGLVVAPGVTERLAENLIQEMPKMLSTHYDHQQEWIFDLVTDPLTGFAESVDEI
FGKVADYHDKRQWDYVIAITDLPMFADKQVMALDINMENGAAIFSYPAFGWRPVKKRFKH
AIYNIIQELNEAEQESRNYDNNKQIENSVKKQFPLSKIDKETIYMKETDSYHLRYLSSSR
SRGMFRLVSGMTFANNPLNMMASLSNIVAIAFTTGAFGLVFTTMWQMAYNFSMWRLFGIS
IIAIIGMLIWIMMSHDLWEPVNKSNHKHITWLYNLTTIMTLIFAIIIYYIILYLLFLIAE
IVLLPSGFLGQQVGLKGPAGIDLYLSIPWFAASISTVAGAIGAGLLNDELIKESTYGYRQ
RVRYEEQRR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcaaaaaactgtgggtctagtcgtcgctccaggtgttactgaacgccttgca
gaaaatctcatacaagaaatgcctaaaatgttatctacacattatgatcatcagcaagaa
tggatttttgatttagttacggatccgcttactggttttgctgaatctgtagatgaaatt
tttgggaaagtagccgattatcacgataagagacaatgggattatgtgatagcaattaca
gatttaccgatgtttgcggacaagcaagtgatggcattagatattaatatggaaaatggt
gcagctatattctcatatccggcatttggctggcgtccagttaaaaaacgtttcaagcat
gcgatttataatattattcaagaattaaatgaagctgaacaagaaagtcgtaattatgat
aataataagcaaatagaaaattcagtaaaaaaacaatttccgctctctaaaatagataaa
gaaacaatatatatgaaagaaacagactcttatcacttaagatatttatcaagttcacgt
tctagaggcatgtttcgccttgttagtggaatgacctttgcgaataatccattaaatatg
atggcaagtttaagtaatatagtagctattgcatttactacaggtgcatttggacttgta
tttacaacgatgtggcaaatggcttataacttttcaatgtggcgcttatttggaatttca
attattgcgattattggaatgctaatatggataatgatgtcacatgatttatgggagcca
gttaataaaagcaaccataagcatattacttggttatacaatcttacaacaataatgaca
ttgatttttgccattataatttattatattattctttatttactattcttaattgctgaa
atcgtattattgccatcaggattcttaggtcagcaagttggattgaaaggtcctgcaggc
attgatttgtatttaagtattccatggtttgcagcttcaatttctacagttgcaggtgca
ataggtgctggtttacttaatgatgaactcattaaagaaagcacatatggatatcgtcag
cgtgtaagatacgaagaacaacgtcgataa

DBGET integrated database retrieval system