KEGG   Staphylococcus epidermidis RP62A: SERP2208Help
Entry
SERP2208          CDS       T00229                                 

Definition
(GenBank) alkaline phosphatase family protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ser  Staphylococcus epidermidis RP62A
Pathway
ser00730  Thiamine metabolism
ser00790  Folate biosynthesis
ser01100  Metabolic pathways
ser02020  Two-component system
Module
ser_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ser00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SERP2208
   00790 Folate biosynthesis
    SERP2208
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SERP2208
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ser04147]
    SERP2208
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ser00537]
    SERP2208
Enzymes [BR:ser01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SERP2208
Exosome [BR:ser04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SERP2208
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ser00537]
 Enzymes
  SERP2208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-ProteinID: AAW53041
UniProt: Q5HKX9
Position
2242520..2243989
Genome map
AA seq 489 aa AA seqDB search
MKFMNKMGKTTLASSIVAASVLSTVNVSYASGSSEQSAQTKQTQNDAIAFGNTKNPKNVI
FMVGDGMGPSFNTAYRYYKNKPGAKKMTPTAFDKYLKGTNRTYSNDPKENVTDSAAGGTA
FSTGHKTYNGAISVDTNKKPIKSVLEQAKEQGKSTGLVTTAELTDATPAVYAAHIDSRDK
KDEIAQQFYNDKINGKHKVDVMLGGGAKYFGKENKNLAKKFKKDGYDIVSNKDELNQSQS
KQVLGTFSEKDMPLQIDAPQSNPLLVDMQNSALNKLSKNNKGFFLMVEGASIDKAAHPND
ITGVMSEMSGFETAFDNAINYAKTHKDTLVVATADHSTGGLSTAKGKDYKWNPEAIHKMK
HSGMYMTKQIADGKDPEKVIKDGYGIDFPNKQLDKVKKAADELHKLQKEGKDDKDEKVVE
QTTKLQNAIQKPINDASHTGWTTNGHTGVDVNTYAYGPGSNKFKGNMENTQSAKNLFDFF
GDNVTSNQN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttatgaacaaaatgggtaagacgacgcttgcttcatcaatcgtagcagcatcc
gttttaagtacggtaaacgtatcatatgcttcaggtagctcagaacaaagtgctcaaact
aagcaaacacaaaacgatgccattgctttcggcaacacaaaaaatccaaaaaatgtcatc
tttatggttggcgatggtatgggaccttcttttaacactgcatatcgctattataaaaat
aagcctggtgctaagaaaatgactccaactgcatttgataaatatctaaaaggaacaaat
cgtacttattctaatgatcctaaagaaaatgttacagactctgctgctggaggaacagct
tttagtaccggtcacaaaacatataacggtgcgattagtgttgatacaaataaaaaacca
attaaatctgtgctagaacaagctaaagaacaaggaaaatcaactggtttagtaactact
gctgaacttactgatgcaacacctgctgtatatgctgctcatatagattcacgcgacaaa
aaagatgaaattgcacagcaattttataatgataaaataaatggcaaacataaagtcgat
gtgatgttaggtggcggtgcaaaatacttcggtaaagaaaataaaaatttagcgaaaaaa
ttcaaaaaagatggttatgatatcgtttctaataaagatgaattaaatcaatcacaaagc
aagcaagttttaggtactttctcagaaaaagatatgccattacaaatagatgcacctcaa
tctaatccgttgctagtagacatgcaaaacagtgcactaaataaattaagtaaaaataat
aaaggattctttttaatggttgagggtgcttcaattgataaagctgcacaccctaatgat
atcactggtgtgatgtctgaaatgtctggtttcgaaacagcttttgataatgctattaat
tatgcaaagacacataaagatacacttgttgtagcaactgcagaccactcaactggtggt
ctatcaaccgcaaaaggtaaagattataaatggaatccagaggctattcacaagatgaaa
cattctggaatgtatatgacaaaacaaatcgctgatggaaaagatcctgaaaaagtaatt
aaagatggatacggcattgatttcccaaataaacaactcgataaagtcaaaaaagcagca
gacgagcttcacaaattacaaaaagaaggtaaagatgacaaagacgaaaaagttgtagaa
caaacaacaaaattacaaaatgcaattcaaaaaccaattaacgatgcttcacacacaggt
tggacaaccaatggccatacaggtgtagatgttaacacatatgcatatgggccaggttct
aacaaattcaaagggaatatggaaaatacccaaagcgctaaaaacttatttgactttttc
ggagacaatgtaacatcaaatcaaaattag

DBGET integrated database retrieval system